Clone GH06387 Report

Search the DGRC for GH06387

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:63
Well:87
Vector:pOT2
Associated Gene/TranscriptSyx17-RA
Protein status:GH06387.pep: gold
Preliminary Size:1233
Sequenced Size:1575

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7452 2001-01-01 Release 2 assignment
CG7452 2001-07-04 Blastp of sequenced clone
CG7452 2003-01-01 Sim4 clustering to Release 3
Syx17 2008-04-29 Release 5.5 accounting
Syx17 2008-08-15 Release 5.9 accounting
Syx17 2008-12-18 5.12 accounting

Clone Sequence Records

GH06387.complete Sequence

1575 bp (1575 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047555

> GH06387.complete
AATAACAAACAAATAATTGGACTGCACAATAGAATTATTATCAGTATAAA
TATAGGGGACAAGACCAGCATGATTGGAACCATGCCACCGTAGTTTCATT
CACAACAACAAAGCACTACTCACTGGAAACATCCCGAAAAGCAAGCAGTG
ACGTCACTGGCAAAACAAAGCAAAAACTGCGCAGAAAAACCAGGGAAATC
TGTTAAGCAAGGTCCATCGTTAAAAAGGGGCGGGGGGTGTTACAGAAACT
GATCCCCCAGATTTCACTTTTACCACAATTAAAACTGATTAAAAATCAAA
GCGCTGCGAGTTCAAAGTATTCAGTTCACGATGACGCGCGATGAGAAACT
GCCACTTAAACAGGCGGAGGTCTCCATCCAAAGGTTTCAGGATGTGGCGG
TGCCCCACCATCTGAGCCTACTGAAAAACCATCGCAGCAATATAGAAAAA
AGCCTGGCGCTCGGCGACTGGCAAAAAATCAAAAAGGAGGAACTCAATGC
TATGAGGGTCATTAAGCAGATCAAGAATCTACTTCTGGAAATGGATGCAC
TGCGAGAAAAAGTACGGGAGGAGGATCTGGAACGTTTCGACGACCTAATG
AAACCTGGCAGGGATACTGCCTTCGCTGGCATGAAGGAATTTGCGGAGCT
CCAACTCAAATCACCCACCTCCACTTTGAGTTCTCAGTACGACGACGATC
TGGACAATCAGCCACAGGAGGTGGATATGAACAGTCTACCCGCACACCGC
CACATGCCCCAGCTGCAACTCAATTTCCAGCTGGAGGAACACCAATTGGC
GCAGAGGCAAGCCTGCCTGGATCAGATGGAGAACCTGCAACAGGAGATCT
ACGATCTGCACGGGATGTTCCAGGGAATGCGTCAACTGACTGCAGAGCAA
TCAGTGGCGGTGGAAAAGATAGCAGACAATGCGGAGGAAGCTCTGGAGAA
TGTCCAGCAGGGCGAATTGAATCTGCGCCGGGCGCTCACCTACAAGAAGG
CCATGTACCCCGTAGTCGGAGCTCTTCTGGGCACCTGTGTGGGAGGACCC
ATTGGTCTGGTGGCGGGCATGAAAGCTGGAGGATTGGCGGCAGTAGGATG
TGGCATCCTCGGCTTCACCGGTGGCTCTGTGCTAAAGGCCAATCCCAATG
TAATGCATGGCAACATCGAGGAGGAGCAGGTGGAACCGGATAGCGAGTCA
ACTGAGAGACTGGAGCTAAAAGAGAAGCCAGAATGACCCGCAGGAGGAAG
TGCCCGATCCGCATCCACGGCTCTGGCCACCACGCACATATGGTCGGCGA
ACACACGACGTTTGGAGGCAGCCACCAACGGAGTGATTTGCAGCGTGCGC
AGCTATTGTTCCGTTCAGTAGAAATTTGACCACGATTTTAGTTCAATATC
CCCATTTTGTGATTTTCCACGTGCAATAGAGCTAATGAGCATAATGTAAC
TGCACTTTAGTTTAAGCGTTGGATACTTGTTGTTCACATGACACCGCAAA
TGTGTGTAGATTTTAAGGCTTTAATATGCAATAATAACTCGTAGCTTTAA
AAAAGTAAAAAAAAAAAAAAAAAAA

GH06387.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-RA 1614 Syx17-RA 45..1602 1..1558 7790 100 Plus
CG15019-RB 870 CG15019-RB 753..870 1558..1441 590 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4403687..4404599 646..1556 4405 99.3 Plus
chr3L 24539361 chr3L 4402926..4403326 1..401 2005 100 Plus
chr3L 24539361 chr3L 4403379..4403626 399..646 1225 99.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-RB 1041 CG7452-PB 1..1041 331..1371 5205 100 Plus
Syx17-RA 906 CG7452-PA 1..906 331..1236 4530 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:34:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-RB 1566 CG7452-RB 11..1566 1..1556 7780 100 Plus
Syx17-RA 1566 CG7452-RA 11..1566 1..1556 7780 100 Plus
CG15019-RB 764 CG15019-RB 723..764 1556..1515 210 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-PB 346 CG7452-PB 1..346 331..1368 1618 99.7 Plus
Syx17-PA 301 CG7452-PA 1..293 331..1209 1494 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4404258..4405170 646..1558 4565 100 Plus
3L 28110227 3L 4403497..4403897 1..401 2005 100 Plus
3L 28110227 3L 4403950..4404197 399..646 1240 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4404258..4405170 646..1558 4565 100 Plus
3L 28103327 3L 4403497..4403897 1..401 2005 100 Plus
3L 28103327 3L 4403950..4404197 399..646 1240 100 Plus
Blast to na_te.dros performed on 2014-11-26 20:28:08 has no hits.

GH06387.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:51:53 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4403688..4404599 647..1556 99   Plus
chr3L 4403380..4403626 400..646 99 -> Plus
chr3L 4402926..4403324 1..399 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:20:38 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 1..906 331..1236 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:29:25 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 1..906 331..1236 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:51:51 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RB 1..1041 331..1371 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:02:50 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 1..906 331..1236 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:51:53 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RB 1..1041 331..1371 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:29:51 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 1..1553 4..1556 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:29:25 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 1..1553 4..1556 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:51:51 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 11..1566 1..1556 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:02:50 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 1..1553 4..1556 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:51:53 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 11..1566 1..1556 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:51:53 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4404259..4405168 647..1556 100   Plus
3L 4403951..4404197 400..646 100 -> Plus
3L 4403497..4403895 1..399 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:51:51 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4404259..4405168 647..1556 100   Plus
arm_3L 4403951..4404197 400..646 100 -> Plus
arm_3L 4403497..4403895 1..399 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:40:51 Download gff for GH06387.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4404259..4405168 647..1556 100   Plus
3L 4403951..4404197 400..646 100 -> Plus
3L 4403497..4403895 1..399 100 -> Plus

GH06387.pep Sequence

Translation from 330 to 1235

> GH06387.pep
MTRDEKLPLKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKI
KKEELNAMRVIKQIKNLLLEMDALREKVREEDLERFDDLMKPGRDTAFAG
MKEFAELQLKSPTSTLSSQYDDDLDNQPQEVDMNSLPAHRHMPQLQLNFQ
LEEHQLAQRQACLDQMENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADN
AEEALENVQQGELNLRRALTYKKAMYPVVGALLGTCVGGPIGLVAGMKAG
GLAAVGCGILGFTGGSVLKANPNVMHGNIEEEQVEPDSESTERLELKEKP
E*

GH06387.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25069-PA 300 GF25069-PA 1..300 1..301 1388 87 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15226-PA 301 GG15226-PA 1..301 1..301 1558 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15679-PA 305 GH15679-PA 1..302 1..299 1154 76.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-PA 301 CG7452-PA 1..301 1..301 1534 100 Plus
Syx17-PB 346 CG7452-PB 1..301 1..301 1534 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12724-PA 298 GI12724-PA 3..298 4..301 1144 75.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17894-PA 303 GL17894-PA 1..303 1..301 1356 85.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20363-PA 303 GA20363-PA 1..303 1..301 1350 85.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14657-PA 268 GM14657-PA 1..268 1..301 1349 87.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13842-PA 301 GD13842-PA 1..301 1..301 1573 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12712-PA 300 GJ12712-PA 1..300 1..301 1171 75.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11715-PA 299 GK11715-PA 1..299 1..301 1271 80.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21445-PA 301 GE21445-PA 1..301 1..301 1572 98.7 Plus

GH06387.hyp Sequence

Translation from 330 to 1235

> GH06387.hyp
MTRDEKLPLKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKI
KKEELNAMRVIKQIKNLLLEMDALREKVREEDLERFDDLMKPGRDTAFAG
MKEFAELQLKSPTSTLSSQYDDDLDNQPQEVDMNSLPAHRHMPQLQLNFQ
LEEHQLAQRQACLDQMENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADN
AEEALENVQQGELNLRRALTYKKAMYPVVGALLGTCVGGPIGLVAGMKAG
GLAAVGCGILGFTGGSVLKANPNVMHGNIEEEQVEPDSESTERLELKEKP
E*

GH06387.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-PA 301 CG7452-PA 1..301 1..301 1534 100 Plus
Syx17-PB 346 CG7452-PB 1..301 1..301 1534 100 Plus