Clone GH07746 Report

Search the DGRC for GH07746

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:77
Well:46
Vector:pOT2
Associated Gene/TranscriptCG9572-RB
Protein status:GH07746.pep: gold
Sequenced Size:1659

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9572 2010-12-02 CDS novel splice

Clone Sequence Records

GH07746.complete Sequence

1659 bp assembled on 2011-01-25

GenBank Submission: BT125943.1

> GH07746.complete
CCAAGTGGGAAATCGCAACCATTTATCAGTTGACACTTTTTGTTTTGTTT
TTTATTTTACGTTCTTTATCTGCTGTAGTGCTAGTGTTTTCTAAGAACTG
AACCCCGAAAATGCAGCTCCTGGTCGTGGCCCTGGTGGCGGTGGCCATCG
CGTCCTTGCCCCAACTGGCCGCAGGTAAAAAGCTGGGGAAGCGCTGCGTG
AACTGCACGTACCGCACTTACTACACCTACGGCGATGGGCGATCCCTGCA
GCGGGTTGTCTATAGAGATCCGGTCTACACACGTGCGCAGTCCTACGCGA
GCGGATGCAGCGGTAGCCCGTGCGGCGTGAACGCCGTGTGCCAGGAGGCC
TCCGGAGGACGGCCCGTCTGCTCGTGCCCGCCCGGATTCAGCGGTAATCC
GCTCACCCACTGCAATCGCGGCGAGTGCCTGGACAACGTCGACTGTCGCG
ACAACCTGCAGTGCAAGGACAATCGCTGCGTTAATCCCTGCGTGGGTGCC
TGTGGCATTGGCTCCAATTGTGACGCCCGCAACCACGTGGCCGTGTGCAG
CTGCCCCGCCGGCTACAATGGCGACCCATACCACGCCTGCCACCTCAACG
ATCCGGAGGAGCAGTGCCATCCCAGTCCGTGCGGCGTTAACACCAAGTGC
GAGATCATCAACGGCGTGCCCACCTGCTCATGCGTTCACGGCTATGTGGG
CAATCCGCTGAGCGGCTGTCGCCACGAGTGCGATCACGATGGCGACTGCA
GCAGCCGGGACATGTGCTCCAGCAACTTCAAGTGCGTGCCGGCATGCGGG
CAGTGCGGCACTGGCGCCACCTGCCGAACGGTCAGCAATCACCGGGCTGT
CTGCGAGTGCCCCAAGGGCTACATTGGCAGCCCGTACACGGAGTGCCGAC
CGGAGTGCTATGGCGATGCCGACTGCCCGGCCGGGCGACCCGCCTGCTTC
TACGGCATCTGCAAGAACACCTGCGAGGGTGCCTGCGGCATCGGCGCCGA
CTGCAACCTGCGCGGCCTCACACCCGTCTGCAGCTGCCCCCGCGACATGA
CCGGCGATCCCTTCGTGCGCTGCCGTCCCTTCACCAAGGAGGACCTTTGC
GACCCCAATCCGTGCGGCACCAACGCCATCTGCGTGCCCGGACACGACAA
CACCGGCCGCGAGCGGCCCGTCTGCAACTGCCTGCCCGGCCACACCGGCA
ATCCGCTGAGCCACTGCACCCGGGGTGAGTGCCTGAGCAACAACGAGTGC
CCCGACCATCGCGCCTGCATCAACTACCAGTGCATCGATCCCTGCATCGG
CAAGTGTGCCACTGGAGCCAGCTGCGAGCCCAAGGCCCACCTGGCTGTCT
GCCGCTGTCCACAGGGACAGTCGGGCGACGCCCTGGTGTCCTGTCGCCAG
ACGCGCACCTTTCCCGTGGCCAAGTACCACTGAGGCGGGATGGGGAGTCG
TATAGTCCCGGAGCCGCACTGCCTGCCAAACCAGTCACCATCCGCCCAGC
CAATCCCCATCCCAATCCGCACCAATCCGCATCTGCCCACTTCCCGTACT
AGTCGTTGCCCTAACCTCGTGCTCTCCCCAACAGAAGCGATAAAAAATGC
GTTGAAAAACAATAAATAATACAAGTAAATAATAATCATAAAAAAAAAAA
AAAAAAAAA

GH07746.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20042753..20043371 606..1224 3095 100 Plus
chrX 22417052 chrX 20043654..20044070 1223..1639 2070 99.8 Plus
chrX 22417052 chrX 20039159..20039399 285..525 1175 99.2 Plus
chrX 22417052 chrX 20038626..20038798 113..285 865 100 Plus
chrX 22417052 chrX 20036716..20036828 1..113 565 100 Plus
chrX 22417052 chrX 20039507..20039588 525..606 395 98.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG9572-RB 1323 CG9572-PB 1..1323 111..1433 6615 100 Plus
CG9572-RA 1326 CG9572-PA 6..1326 113..1433 6605 100 Plus
CG9572-RD 1215 CG9572-PD 67..1215 285..1433 5745 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG9572-RB 1664 CG9572-RB 26..1664 1..1639 8195 100 Plus
CG9572-RA 1667 CG9572-RA 26..1667 1..1639 8130 99.8 Plus
CG9572-RD 1556 CG9572-RD 202..1556 285..1639 6775 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9572-PB 440 CG9572-PB 17..440 159..1430 2452 100 Plus
CG9572-PA 441 CG9572-PA 18..441 159..1430 2452 100 Plus
CG9572-PD 404 CG9572-PD 18..404 270..1430 2280 99 Plus
dp-PZ 15998 CG33196-PZ 13030..13462 261..1415 801 37.9 Plus
dp-PY 18095 CG33196-PY 15140..15559 306..1415 799 38.1 Plus
dp-PZ 15998 CG33196-PZ 5698..6119 297..1415 778 36.8 Plus
dp-PZ 15998 CG33196-PZ 12402..12824 306..1418 774 36.6 Plus
dp-PZ 15998 CG33196-PZ 6553..6970 306..1394 769 37.7 Plus
dp-PZ 15998 CG33196-PZ 8577..8992 306..1397 765 36.8 Plus
dp-PZ 15998 CG33196-PZ 11126..11538 306..1394 764 35.2 Plus
dp-PZ 15998 CG33196-PZ 6237..6645 306..1397 758 36.3 Plus
dp-PZ 15998 CG33196-PZ 9852..10265 306..1403 757 37 Plus
dp-PZ 15998 CG33196-PZ 7938..8353 306..1394 753 35 Plus
dp-PZ 15998 CG33196-PZ 12727..13144 306..1421 747 37.2 Plus
dp-PZ 15998 CG33196-PZ 13471..13890 306..1406 744 36.3 Plus
dp-PZ 15998 CG33196-PZ 4946..5369 306..1418 742 36.1 Plus
dp-PZ 15998 CG33196-PZ 7198..7609 306..1394 742 37.2 Plus
dp-PZ 15998 CG33196-PZ 9093..9521 243..1394 740 37.3 Plus
dp-PZ 15998 CG33196-PZ 8903..9312 306..1415 738 35.2 Plus
dp-PZ 15998 CG33196-PZ 13367..13787 306..1415 732 36.8 Plus
dp-PZ 15998 CG33196-PZ 7300..7723 306..1424 731 33.9 Plus
dp-PZ 15998 CG33196-PZ 11450..11857 306..1397 731 35.4 Plus
dp-PZ 15998 CG33196-PZ 13144..13562 285..1394 730 36.5 Plus
dp-PZ 15998 CG33196-PZ 8157..8564 306..1397 728 35.5 Plus
dp-PZ 15998 CG33196-PZ 9299..9766 231..1493 728 34.2 Plus
dp-PZ 15998 CG33196-PZ 4094..4519 306..1430 726 34.9 Plus
dp-PZ 15998 CG33196-PZ 5375..5800 306..1415 724 34.2 Plus
dp-PZ 15998 CG33196-PZ 10909..11323 294..1394 724 35.5 Plus
dp-PZ 15998 CG33196-PZ 4841..5280 306..1499 720 35 Plus
dp-PZ 15998 CG33196-PZ 8784..9206 273..1415 720 36.1 Plus
dp-PZ 15998 CG33196-PZ 9430..9842 306..1406 720 36.3 Plus
dp-PZ 15998 CG33196-PZ 10382..10796 306..1394 719 36.4 Plus
dp-PZ 15998 CG33196-PZ 6129..6561 306..1481 717 35.2 Plus
dp-PZ 15998 CG33196-PZ 7407..7824 306..1415 717 35.6 Plus
dp-PZ 15998 CG33196-PZ 7832..8249 306..1397 717 35 Plus
dp-PZ 15998 CG33196-PZ 4497..4932 234..1394 713 34.4 Plus
dp-PZ 15998 CG33196-PZ 7627..8030 306..1394 713 35.2 Plus
dp-PZ 15998 CG33196-PZ 5594..6005 306..1394 712 37 Plus
dp-PZ 15998 CG33196-PZ 5908..6328 288..1394 711 36.9 Plus
dp-PZ 15998 CG33196-PZ 10174..10580 306..1400 708 34.8 Plus
dp-PZ 15998 CG33196-PZ 8048..8463 306..1418 707 34.7 Plus
dp-PZ 15998 CG33196-PZ 12076..12498 270..1406 706 33.8 Plus
dp-PZ 15998 CG33196-PZ 9540..9944 306..1394 703 34.7 Plus
dp-PZ 15998 CG33196-PZ 10274..10684 306..1394 700 36 Plus
dp-PZ 15998 CG33196-PZ 10486..10901 306..1394 698 35 Plus
dp-PZ 15998 CG33196-PZ 5270..5695 306..1418 697 35.7 Plus
dp-PZ 15998 CG33196-PZ 13793..14171 306..1415 695 37.7 Plus
dp-PZ 15998 CG33196-PZ 6986..7394 306..1400 694 35.1 Plus
dp-PZ 15998 CG33196-PZ 12496..12923 258..1400 693 36 Plus
dp-PZ 15998 CG33196-PZ 6648..7075 270..1397 692 34 Plus
dp-PZ 15998 CG33196-PZ 6757..7179 270..1394 692 35.3 Plus
dp-PZ 15998 CG33196-PZ 5052..5489 306..1481 691 33.5 Plus
dp-PZ 15998 CG33196-PZ 9941..10385 261..1481 684 33.3 Plus
dp-PZ 15998 CG33196-PZ 4728..5144 282..1394 681 33.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20154197..20154815 606..1224 3095 100 Plus
X 23542271 X 20155098..20155517 1223..1642 2100 100 Plus
X 23542271 X 20150597..20150837 285..525 1205 100 Plus
X 23542271 X 20150064..20150236 113..285 865 100 Plus
X 23542271 X 20148149..20148261 1..113 565 100 Plus
X 23542271 X 20150945..20151026 525..606 410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20162295..20162913 606..1224 3095 100 Plus
X 23527363 X 20163196..20163615 1223..1642 2100 100 Plus
X 23527363 X 20158695..20158935 285..525 1205 100 Plus
X 23527363 X 20158162..20158334 113..285 865 100 Plus
X 23527363 X 20156247..20156359 1..113 565 100 Plus
X 23527363 X 20159043..20159124 525..606 410 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:58:08 has no hits.

GH07746.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 18:01:57 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20043655..20044070 1224..1639 99   Plus
chrX 20042754..20043370 607..1223 100 -> Plus
chrX 20039507..20039588 525..606 98 -> Plus
chrX 20039160..20039398 286..524 99 -> Plus
chrX 20038627..20038798 114..285 100 -> Plus
chrX 20036716..20036828 1..113 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-25 17:09:48 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
CG9572-RB 1..1323 111..1433 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:42:52 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
CG9572-RB 1..1323 111..1433 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:01:57 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
CG9572-RB 1..1323 111..1433 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:09:47 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
CG9572-RB 24..1662 1..1639 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:42:52 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
CG9572-RB 26..1664 1..1639 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:01:57 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
CG9572-RB 26..1664 1..1639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 18:01:57 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
X 20155099..20155514 1224..1639 100   Plus
X 20154198..20154814 607..1223 100 -> Plus
X 20150945..20151026 525..606 100 -> Plus
X 20150598..20150836 286..524 100 -> Plus
X 20150065..20150236 114..285 100 -> Plus
X 20148149..20148261 1..113 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:42:52 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20049132..20049547 1224..1639 100   Plus
arm_X 20048231..20048847 607..1223 100 -> Plus
arm_X 20044978..20045059 525..606 100 -> Plus
arm_X 20044631..20044869 286..524 100 -> Plus
arm_X 20044098..20044269 114..285 100 -> Plus
arm_X 20042182..20042294 1..113 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:56:00 Download gff for GH07746.complete
Subject Subject Range Query Range Percent Splice Strand
X 20163197..20163612 1224..1639 100   Plus
X 20162296..20162912 607..1223 100 -> Plus
X 20159043..20159124 525..606 100 -> Plus
X 20158696..20158934 286..524 100 -> Plus
X 20158163..20158334 114..285 100 -> Plus
X 20156247..20156359 1..113 100 -> Plus

GH07746.pep Sequence

Translation from 110 to 1432

> GH07746.pep
MQLLVVALVAVAIASLPQLAAGKKLGKRCVNCTYRTYYTYGDGRSLQRVV
YRDPVYTRAQSYASGCSGSPCGVNAVCQEASGGRPVCSCPPGFSGNPLTH
CNRGECLDNVDCRDNLQCKDNRCVNPCVGACGIGSNCDARNHVAVCSCPA
GYNGDPYHACHLNDPEEQCHPSPCGVNTKCEIINGVPTCSCVHGYVGNPL
SGCRHECDHDGDCSSRDMCSSNFKCVPACGQCGTGATCRTVSNHRAVCEC
PKGYIGSPYTECRPECYGDADCPAGRPACFYGICKNTCEGACGIGADCNL
RGLTPVCSCPRDMTGDPFVRCRPFTKEDLCDPNPCGTNAICVPGHDNTGR
ERPVCNCLPGHTGNPLSHCTRGECLSNNECPDHRACINYQCIDPCIGKCA
TGASCEPKAHLAVCRCPQGQSGDALVSCRQTRTFPVAKYH*

GH07746.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20236-PA 457 GF20236-PA 32..457 13..440 2043 93 Plus
Dana\GF23960-PA 2634 GF23960-PA 2214..2611 71..436 316 32 Plus
Dana\GF23960-PA 2634 GF23960-PA 2047..2440 71..432 306 32.8 Plus
Dana\GF23960-PA 2634 GF23960-PA 896..1281 66..423 290 32.1 Plus
Dana\GF23960-PA 2634 GF23960-PA 1185..1635 66..425 227 28 Plus
Dana\GF23960-PA 2634 GF23960-PA 677..1004 71..431 211 30.1 Plus
Dana\GF23960-PA 2634 GF23960-PA 1318..1731 63..417 209 30.5 Plus
Dana\GF23960-PA 2634 GF23960-PA 782..1224 71..433 209 29.1 Plus
Dana\GF23960-PA 2634 GF23960-PA 1633..2071 53..423 197 28.2 Plus
Dana\GF23960-PA 2634 GF23960-PA 1538..1921 66..414 191 29.4 Plus
Dana\GF23960-PA 2634 GF23960-PA 998..1351 63..365 175 27.7 Plus
Dana\GF23960-PA 2634 GF23960-PA 7..314 71..392 166 29.4 Plus
Dana\GF23960-PA 2634 GF23960-PA 730..1140 64..431 160 25.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19272-PA 441 GG19272-PA 14..441 13..440 2156 97.7 Plus
Dere\GG24368-PA 4310 GG24368-PA 3865..4255 84..428 431 34.8 Plus
Dere\GG24368-PA 4310 GG24368-PA 3651..4049 71..435 412 31.1 Plus
Dere\GG24368-PA 4310 GG24368-PA 3954..4257 66..323 375 36.9 Plus
Dere\GG24368-PA 4310 GG24368-PA 3412..3816 71..416 317 29.6 Plus
Dere\GG24368-PA 4310 GG24368-PA 2294..2691 66..432 307 32.4 Plus
Dere\GG24368-PA 4310 GG24368-PA 2465..2858 71..429 303 31.9 Plus
Dere\GG24368-PA 4310 GG24368-PA 1148..1533 66..423 280 32.1 Plus
Dere\GG24368-PA 4310 GG24368-PA 4057..4258 66..265 270 39.4 Plus
Dere\GG24368-PA 4310 GG24368-PA 2231..2559 66..432 264 28.1 Plus
Dere\GG24368-PA 4310 GG24368-PA 3508..3946 65..429 244 27.3 Plus
Dere\GG24368-PA 4310 GG24368-PA 1437..1887 66..425 224 27.8 Plus
Dere\GG24368-PA 4310 GG24368-PA 2061..2494 100..428 213 27.7 Plus
Dere\GG24368-PA 4310 GG24368-PA 815..1256 54..431 210 28.6 Plus
Dere\GG24368-PA 4310 GG24368-PA 1649..2117 66..423 205 27.3 Plus
Dere\GG24368-PA 4310 GG24368-PA 1107..1476 64..433 202 29.8 Plus
Dere\GG24368-PA 4310 GG24368-PA 2885..3198 106..433 201 29.6 Plus
Dere\GG24368-PA 4310 GG24368-PA 982..1336 64..415 195 27.1 Plus
Dere\GG24368-PA 4310 GG24368-PA 3305..3681 87..429 188 26.9 Plus
Dere\GG24368-PA 4310 GG24368-PA 2658..2947 174..437 186 29.9 Plus
Dere\GG24368-PA 4310 GG24368-PA 1885..2323 53..423 186 27.3 Plus
Dere\GG24368-PA 4310 GG24368-PA 3137..3503 106..429 175 27.1 Plus
Dere\GG24368-PA 4310 GG24368-PA 3030..3443 66..430 175 29.6 Plus
Dere\GG24368-PA 4310 GG24368-PA 1250..1603 63..365 166 26.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24631-PA 437 GH24631-PA 4..437 5..440 1953 85.1 Plus
Dgri\GH13743-PA 7303 GH13743-PA 4340..4767 54..428 570 36.7 Plus
Dgri\GH13743-PA 7303 GH13743-PA 3655..4117 66..436 527 32.4 Plus
Dgri\GH13743-PA 7303 GH13743-PA 4679..5092 66..433 523 37.4 Plus
Dgri\GH13743-PA 7303 GH13743-PA 4779..5197 66..432 523 37.2 Plus
Dgri\GH13743-PA 7303 GH13743-PA 4215..4662 33..429 520 34.5 Plus
Dgri\GH13743-PA 7303 GH13743-PA 3859..4350 32..440 486 31.7 Plus
Dgri\GH13743-PA 7303 GH13743-PA 5164..5608 71..430 442 33.5 Plus
Dgri\GH13743-PA 7303 GH13743-PA 5378..5803 66..435 402 32.7 Plus
Dgri\GH13743-PA 7303 GH13743-PA 5335..5734 84..428 394 34 Plus
Dgri\GH13743-PA 7303 GH13743-PA 5105..5477 71..435 381 32 Plus
Dgri\GH13743-PA 7303 GH13743-PA 6292..6703 71..436 368 32.4 Plus
Dgri\GH13743-PA 7303 GH13743-PA 3437..3752 71..433 353 33.1 Plus
Dgri\GH13743-PA 7303 GH13743-PA 6095..6517 67..434 338 32 Plus
Dgri\GH13743-PA 7303 GH13743-PA 5607..6067 51..428 338 29.7 Plus
Dgri\GH13743-PA 7303 GH13743-PA 5717..6128 84..428 328 31.4 Plus
Dgri\GH13743-PA 7303 GH13743-PA 5506..5939 70..433 319 30.1 Plus
Dgri\GH13743-PA 7303 GH13743-PA 3525..3881 57..436 305 29.9 Plus
Dgri\GH13743-PA 7303 GH13743-PA 6352..6774 70..438 297 30.3 Plus
Dgri\GH13743-PA 7303 GH13743-PA 1171..1556 66..423 294 32.4 Plus
Dgri\GH13743-PA 7303 GH13743-PA 6154..6579 66..432 290 31.4 Plus
Dgri\GH13743-PA 7303 GH13743-PA 2490..2887 71..436 281 31.1 Plus
Dgri\GH13743-PA 7303 GH13743-PA 2319..2716 66..432 274 31.2 Plus
Dgri\GH13743-PA 7303 GH13743-PA 2251..2580 61..428 242 27.3 Plus
Dgri\GH13743-PA 7303 GH13743-PA 6496..6915 86..431 235 28.7 Plus
Dgri\GH13743-PA 7303 GH13743-PA 1273..1625 63..423 227 28.6 Plus
Dgri\GH13743-PA 7303 GH13743-PA 1672..2142 66..423 222 27.9 Plus
Dgri\GH13743-PA 7303 GH13743-PA 1117..1457 54..431 222 30.4 Plus
Dgri\GH13743-PA 7303 GH13743-PA 2779..3223 66..433 220 28.1 Plus
Dgri\GH13743-PA 7303 GH13743-PA 6546..6913 71..370 208 30.9 Plus
Dgri\GH13743-PA 7303 GH13743-PA 1009..1359 67..415 194 26.9 Plus
Dgri\GH13743-PA 7303 GH13743-PA 1905..2348 51..423 186 27.5 Plus
Dgri\GH13743-PA 7303 GH13743-PA 838..1279 54..431 181 27.4 Plus
Dgri\GH13743-PA 7303 GH13743-PA 3055..3468 66..430 174 29.3 Plus
Dgri\GH13743-PA 7303 GH13743-PA 6593..6912 58..321 162 28.4 Plus
Dgri\GH13743-PA 7303 GH13743-PA 702..982 71..429 154 28.8 Plus
Dgri\GH13743-PA 7303 GH13743-PA 160..380 66..342 153 31.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9572-PB 440 CG9572-PB 1..440 1..440 2574 100 Plus
CG9572-PA 441 CG9572-PA 3..441 2..440 2569 100 Plus
CG9572-PD 404 CG9572-PD 3..404 2..440 2314 91.6 Plus
dp-PZ 15998 CG33196-PZ 13030..13462 51..435 801 37.9 Plus
dp-PY 18095 CG33196-PY 15140..15559 66..435 799 38.1 Plus
dp-PZ 15998 CG33196-PZ 5698..6119 63..435 778 36.8 Plus
dp-PZ 15998 CG33196-PZ 12402..12824 66..436 774 36.6 Plus
dp-PZ 15998 CG33196-PZ 6553..6970 66..428 769 37.7 Plus
dp-PZ 15998 CG33196-PZ 8577..8992 66..429 765 36.8 Plus
dp-PZ 15998 CG33196-PZ 11126..11538 66..428 764 35.2 Plus
dp-PZ 15998 CG33196-PZ 6237..6645 66..429 758 36.3 Plus
dp-PZ 15998 CG33196-PZ 9852..10265 66..431 757 37 Plus
dp-PZ 15998 CG33196-PZ 7938..8353 66..428 753 35 Plus
dp-PZ 15998 CG33196-PZ 12727..13144 66..437 747 37.2 Plus
dp-PZ 15998 CG33196-PZ 13471..13890 66..432 744 36.3 Plus
dp-PZ 15998 CG33196-PZ 4946..5369 66..436 742 36.1 Plus
dp-PZ 15998 CG33196-PZ 7198..7609 66..428 742 37.2 Plus
dp-PZ 15998 CG33196-PZ 9071..9521 29..428 741 36 Plus
dp-PZ 15998 CG33196-PZ 8903..9312 66..435 738 35.2 Plus
dp-PZ 15998 CG33196-PZ 13367..13787 66..435 732 36.8 Plus
dp-PZ 15998 CG33196-PZ 7300..7723 66..438 731 33.9 Plus
dp-PZ 15998 CG33196-PZ 11450..11857 66..429 731 35.4 Plus
dp-PZ 15998 CG33196-PZ 13144..13562 59..428 730 36.5 Plus
dp-PZ 15998 CG33196-PZ 8157..8564 66..429 728 35.5 Plus
dp-PZ 15998 CG33196-PZ 4094..4519 66..440 726 34.9 Plus
dp-PZ 15998 CG33196-PZ 7377..7824 31..435 725 34.7 Plus
dp-PZ 15998 CG33196-PZ 9291..9740 32..436 725 34.6 Plus
dp-PZ 15998 CG33196-PZ 5375..5800 66..435 724 34.2 Plus
dp-PZ 15998 CG33196-PZ 10909..11323 62..428 724 35.5 Plus
dp-PZ 15998 CG33196-PZ 8784..9206 55..435 720 36.1 Plus
dp-PZ 15998 CG33196-PZ 9430..9842 66..432 720 36.3 Plus
dp-PZ 15998 CG33196-PZ 10382..10796 66..428 719 36.4 Plus
dp-PZ 15998 CG33196-PZ 6085..6540 19..428 717 33.7 Plus
dp-PZ 15998 CG33196-PZ 7832..8249 66..429 717 35 Plus
dp-PZ 15998 CG33196-PZ 4497..4932 42..428 713 34.4 Plus
dp-PZ 15998 CG33196-PZ 7627..8030 66..428 713 35.2 Plus
dp-PZ 15998 CG33196-PZ 4841..5258 66..435 712 35.7 Plus
dp-PZ 15998 CG33196-PZ 5594..6005 66..428 712 37 Plus
dp-PZ 15998 CG33196-PZ 5908..6328 60..428 711 36.9 Plus
dp-PZ 15998 CG33196-PZ 8016..8463 32..436 711 34.1 Plus
dp-PZ 15998 CG33196-PZ 11342..11751 66..430 709 36.4 Plus
dp-PZ 15998 CG33196-PZ 10174..10580 66..430 708 34.8 Plus
dp-PZ 15998 CG33196-PZ 12076..12498 54..432 706 33.8 Plus
dp-PZ 15998 CG33196-PZ 9540..9944 66..428 703 34.7 Plus
dp-PZ 15998 CG33196-PZ 10274..10684 66..428 700 36 Plus
dp-PZ 15998 CG33196-PZ 10486..10901 66..428 698 35 Plus
dp-PZ 15998 CG33196-PZ 5270..5695 66..436 697 35.7 Plus
dp-PZ 15998 CG33196-PZ 5476..5897 51..428 696 34.5 Plus
dp-PZ 15998 CG33196-PZ 13793..14171 66..435 695 37.7 Plus
dp-PZ 15998 CG33196-PZ 6986..7394 66..430 694 35.1 Plus
dp-PZ 15998 CG33196-PZ 12496..12923 50..430 693 36 Plus
dp-PZ 15998 CG33196-PZ 6648..7075 54..429 692 34 Plus
dp-PZ 15998 CG33196-PZ 6757..7179 54..428 692 35.3 Plus
dp-PZ 15998 CG33196-PZ 5052..5467 66..428 685 33.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15819-PA 400 GI15819-PA 9..400 46..440 1812 89.6 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 5210..5633 66..436 526 35.5 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 4345..4771 53..428 523 36.2 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 5316..5738 66..435 512 33.9 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 5402..5851 43..438 506 33.5 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 5103..5515 64..428 486 35.1 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 4889..5307 60..434 486 33.9 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 5733..6182 49..428 482 32.9 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 5857..6253 66..438 482 37 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 4455..4885 56..435 478 33.6 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 4676..5103 63..437 465 33.6 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 5951..6376 54..429 388 32.8 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 6346..6757 71..436 387 33.1 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 4047..4454 66..428 382 33.9 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 3410..3814 71..416 334 31.5 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 6406..6828 70..438 309 31.2 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 6208..6633 66..432 302 31.6 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 1143..1531 66..425 297 32.6 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 2292..2689 66..432 285 31.9 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 2463..2856 71..429 284 31.4 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 3847..4181 61..370 267 33.1 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 3928..4353 76..431 267 28.2 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 3261..3519 106..342 251 35.1 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 6550..6969 86..431 245 29.4 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 3498..3883 57..430 234 30.3 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 3546..3936 61..421 226 26.9 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 2087..2557 67..432 224 27.7 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 1645..2115 66..423 222 29.1 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 2883..3196 106..433 214 30.4 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 1102..1430 64..431 214 30.3 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 3649..4084 71..431 211 26.7 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 6600..6967 71..370 202 30.3 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 1777..2171 57..414 199 29.9 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 1208..1613 63..435 193 26.2 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 1433..1883 66..425 187 26.5 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 3135..3501 106..429 186 28 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 2910..3318 71..429 181 28.4 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 2714..3115 68..415 176 27.8 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 1878..2321 51..423 171 27.1 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 924..1332 71..415 165 24.9 Plus
Dmoj\GI17886-PA 7357 GI17886-PA 6647..6966 58..321 163 28.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13078-PA 424 GL13078-PA 7..424 2..440 1975 87.7 Plus
Dper\GL14154-PA 387 GL14154-PA 2..352 70..432 414 36.1 Plus
Dper\GL14154-PA 387 GL14154-PA 50..370 66..338 370 32.9 Plus
Dper\GL14154-PA 387 GL14154-PA 1..150 290..440 234 35.6 Plus
Dper\GL19750-PA 141 GL19750-PA 3..137 297..432 203 36.2 Plus
Dper\GL19750-PA 141 GL19750-PA 3..131 136..260 202 41.2 Plus
Dper\GL14154-PA 387 GL14154-PA 234..383 43..190 197 37.3 Plus
Dper\GL19750-PA 141 GL19750-PA 41..132 66..159 174 43.6 Plus
Dper\GL19750-PA 141 GL19750-PA 3..130 179..318 173 35.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21884-PA 442 GA21884-PA 7..442 2..440 2092 91.6 Plus
Dpse\GA26108-PA 17011 GA26108-PA 5949..6379 54..435 583 37.2 Plus
Dpse\GA26108-PA 17011 GA26108-PA 8558..8992 54..435 571 35.9 Plus
Dpse\GA26108-PA 17011 GA26108-PA 8155..8564 71..436 561 36.2 Plus
Dpse\GA26108-PA 17011 GA26108-PA 14056..14476 71..438 551 37.3 Plus
Dpse\GA26108-PA 17011 GA26108-PA 14374..14796 62..435 550 38.5 Plus
Dpse\GA26108-PA 17011 GA26108-PA 14481..14899 66..432 549 36.7 Plus
Dpse\GA26108-PA 17011 GA26108-PA 6807..7233 59..430 544 36.6 Plus
Dpse\GA26108-PA 17011 GA26108-PA 7460..7873 66..431 538 35.7 Plus
Dpse\GA26108-PA 17011 GA26108-PA 9859..10284 49..429 535 35.1 Plus
Dpse\GA26108-PA 17011 GA26108-PA 5208..5631 66..436 535 35.2 Plus
Dpse\GA26108-PA 17011 GA26108-PA 8239..8674 47..439 535 34.1 Plus
Dpse\GA26108-PA 17011 GA26108-PA 8442..8879 43..428 528 36.8 Plus
Dpse\GA26108-PA 17011 GA26108-PA 11140..11567 55..428 528 36.6 Plus
Dpse\GA26108-PA 17011 GA26108-PA 6488..6906 57..429 526 35.9 Plus
Dpse\GA26108-PA 17011 GA26108-PA 9635..10068 43..428 522 34.9 Plus
Dpse\GA26108-PA 17011 GA26108-PA 5626..6059 55..434 519 33.5 Plus
Dpse\GA26108-PA 17011 GA26108-PA 9213..9648 38..432 519 34 Plus
Dpse\GA26108-PA 17011 GA26108-PA 12031..12454 57..428 518 36.2 Plus
Dpse\GA26108-PA 17011 GA26108-PA 7131..7559 57..436 517 36.9 Plus
Dpse\GA26108-PA 17011 GA26108-PA 6151..6594 43..434 516 35.2 Plus
Dpse\GA26108-PA 17011 GA26108-PA 5855..6265 66..428 514 36.5 Plus
Dpse\GA26108-PA 17011 GA26108-PA 4353..4775 66..437 513 36 Plus
Dpse\GA26108-PA 17011 GA26108-PA 11787..12253 54..439 511 33.2 Plus
Dpse\GA26108-PA 17011 GA26108-PA 10819..11247 52..432 511 34.5 Plus
Dpse\GA26108-PA 17011 GA26108-PA 6345..6805 19..432 507 33.5 Plus
Dpse\GA26108-PA 17011 GA26108-PA 5731..6164 49..435 506 34.4 Plus
Dpse\GA26108-PA 17011 GA26108-PA 5532..5954 66..435 505 35.2 Plus
Dpse\GA26108-PA 17011 GA26108-PA 10496..10920 53..429 503 35.2 Plus
Dpse\GA26108-PA 17011 GA26108-PA 5311..5736 63..435 502 33.4 Plus
Dpse\GA26108-PA 17011 GA26108-PA 11046..11463 66..429 502 35.3 Plus
Dpse\GA26108-PA 17011 GA26108-PA 10195..10612 66..439 501 33.9 Plus
Dpse\GA26108-PA 17011 GA26108-PA 7660..8086 57..435 501 33.9 Plus
Dpse\GA26108-PA 17011 GA26108-PA 8656..9111 41..429 497 32.3 Plus
Dpse\GA26108-PA 17011 GA26108-PA 14154..14572 61..428 497 34.9 Plus
Dpse\GA26108-PA 17011 GA26108-PA 7224..7658 42..432 496 33.5 Plus
Dpse\GA26108-PA 17011 GA26108-PA 10087..10505 66..439 495 35.1 Plus
Dpse\GA26108-PA 17011 GA26108-PA 6909..7337 54..429 493 34 Plus
Dpse\GA26108-PA 17011 GA26108-PA 5403..5848 47..437 492 32.7 Plus
Dpse\GA26108-PA 17011 GA26108-PA 11240..11677 38..431 491 33.9 Plus
Dpse\GA26108-PA 17011 GA26108-PA 14802..15181 66..435 490 38 Plus
Dpse\GA26108-PA 17011 GA26108-PA 4893..5305 66..434 484 35.2 Plus
Dpse\GA26108-PA 17011 GA26108-PA 7889..8358 66..440 484 31.3 Plus
Dpse\GA26108-PA 17011 GA26108-PA 7779..8189 66..433 483 34.3 Plus
Dpse\GA26108-PA 17011 GA26108-PA 8897..9333 66..439 482 32.7 Plus
Dpse\GA26108-PA 17011 GA26108-PA 11364..11784 48..429 478 34.6 Plus
Dpse\GA26108-PA 17011 GA26108-PA 10296..10707 66..428 470 32.9 Plus
Dpse\GA26108-PA 17011 GA26108-PA 5100..5517 63..432 466 34.8 Plus
Dpse\GA26108-PA 17011 GA26108-PA 10932..11359 62..439 466 33.7 Plus
Dpse\GA26108-PA 17011 GA26108-PA 4671..5101 63..437 462 33.1 Plus
Dpse\GA26108-PA 17011 GA26108-PA 6594..7023 56..435 459 33.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23011-PA 389 GM23011-PA 15..379 13..371 1565 86.2 Plus
Dsec\GM18084-PA 14551 GM18084-PA 11616..12035 66..435 554 37.2 Plus
Dsec\GM18084-PA 14551 GM18084-PA 8501..8933 38..433 534 35.2 Plus
Dsec\GM18084-PA 14551 GM18084-PA 5084..5507 66..436 530 35.2 Plus
Dsec\GM18084-PA 14551 GM18084-PA 11510..11925 66..429 528 36.7 Plus
Dsec\GM18084-PA 14551 GM18084-PA 9446..9859 66..435 521 35.1 Plus
Dsec\GM23011-PA 389 GM23011-PA 68..389 169..440 518 45.6 Plus
Dsec\GM18084-PA 14551 GM18084-PA 9128..9535 66..429 513 34.9 Plus
Dsec\GM18084-PA 14551 GM18084-PA 4311..4736 66..440 512 35.1 Plus
Dsec\GM18084-PA 14551 GM18084-PA 11940..12358 66..433 511 36.6 Plus
Dsec\GM18084-PA 14551 GM18084-PA 5944..6312 58..410 507 39.7 Plus
Dsec\GM18084-PA 14551 GM18084-PA 5513..5942 66..435 504 34.2 Plus
Dsec\GM18084-PA 14551 GM18084-PA 12039..12463 61..432 502 35.5 Plus
Dsec\GM18084-PA 14551 GM18084-PA 4979..5396 66..435 499 34.7 Plus
Dsec\GM18084-PA 14551 GM18084-PA 10583..10951 66..428 498 39.4 Plus
Dsec\GM18084-PA 14551 GM18084-PA 12371..12744 71..435 495 37.1 Plus
Dsec\GM18084-PA 14551 GM18084-PA 5408..5825 66..431 494 35.6 Plus
Dsec\GM18084-PA 14551 GM18084-PA 4713..5181 41..434 494 31.5 Plus
Dsec\GM18084-PA 14551 GM18084-PA 8840..9221 66..432 492 36.8 Plus
Dsec\GM18084-PA 14551 GM18084-PA 5607..6043 49..428 491 34.1 Plus
Dsec\GM18084-PA 14551 GM18084-PA 10189..10581 66..440 490 35.7 Plus
Dsec\GM18084-PA 14551 GM18084-PA 8213..8618 66..439 490 34.4 Plus
Dsec\GM18084-PA 14551 GM18084-PA 5177..5612 46..435 488 31.9 Plus
Dsec\GM18084-PA 14551 GM18084-PA 4863..5284 55..430 485 33.3 Plus
Dsec\GM18084-PA 14551 GM18084-PA 7378..7787 32..430 484 34.9 Plus
Dsec\GM18084-PA 14551 GM18084-PA 9220..9638 46..428 481 34.1 Plus
Dsec\GM18084-PA 14551 GM18084-PA 6673..7118 71..438 470 33 Plus
Dsec\GM18084-PA 14551 GM18084-PA 6490..6891 48..433 469 35.3 Plus
Dsec\GM18084-PA 14551 GM18084-PA 8607..9038 51..435 467 33.2 Plus
Dsec\GM18084-PA 14551 GM18084-PA 6614..6992 66..428 454 35.5 Plus
Dsec\GM18084-PA 14551 GM18084-PA 9639..10075 51..436 452 32.1 Plus
Dsec\GM18084-PA 14551 GM18084-PA 12139..12560 54..438 450 31.4 Plus
Dsec\GM18084-PA 14551 GM18084-PA 7012..7402 66..438 440 34.1 Plus
Dsec\GM18084-PA 14551 GM18084-PA 4516..4970 46..431 433 31.7 Plus
Dsec\GM18084-PA 14551 GM18084-PA 10374..10841 66..429 432 31.5 Plus
Dsec\GM18084-PA 14551 GM18084-PA 8384..8824 58..429 430 31.9 Plus
Dsec\GM18084-PA 14551 GM18084-PA 12430..12885 71..440 430 32.3 Plus
Dsec\GM18084-PA 14551 GM18084-PA 7195..7664 66..428 425 30.8 Plus
Dsec\GM18084-PA 14551 GM18084-PA 9749..10173 54..428 423 32.4 Plus
Dsec\GM18084-PA 14551 GM18084-PA 10749..11145 66..410 422 34.5 Plus
Dsec\GM18084-PA 14551 GM18084-PA 7767..8185 34..440 421 31.8 Plus
Dsec\GM18084-PA 14551 GM18084-PA 5844..6228 66..434 405 32.4 Plus
Dsec\GM18084-PA 14551 GM18084-PA 10082..10467 66..430 400 33.9 Plus
Dsec\GM18084-PA 14551 GM18084-PA 9547..9962 66..428 398 31.2 Plus
Dsec\GM18084-PA 14551 GM18084-PA 12639..13063 60..428 380 32.8 Plus
Dsec\GM18084-PA 14551 GM18084-PA 9846..10266 41..414 379 30.2 Plus
Dsec\GM18084-PA 14551 GM18084-PA 3998..4407 64..428 377 34 Plus
Dsec\GM18084-PA 14551 GM18084-PA 6124..6602 59..432 375 29 Plus
Dsec\GM18084-PA 14551 GM18084-PA 13540..13951 71..436 374 31.9 Plus
Dsec\GM18084-PA 14551 GM18084-PA 13229..13692 58..429 366 31.1 Plus
Dsec\GM18084-PA 14551 GM18084-PA 8699..9160 32..429 365 29.5 Plus
Dsec\GM18084-PA 14551 GM18084-PA 6394..6703 124..429 354 34.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17480-PA 429 GD17480-PA 14..232 13..216 786 76.3 Plus
Dsim\GD22701-PA 3703 GD22701-PA 1612..2069 32..440 557 33.9 Plus
Dsim\GD22700-PA 3314 GD22700-PA 1665..2097 44..429 544 35.5 Plus
Dsim\GD22700-PA 3314 GD22700-PA 2549..2971 66..439 522 35 Plus
Dsim\GD22701-PA 3703 GD22701-PA 1307..1739 51..432 513 33.8 Plus
Dsim\GD22701-PA 3703 GD22701-PA 1171..1531 46..440 507 38.6 Plus
Dsim\GD22700-PA 3314 GD22700-PA 2337..2748 66..433 496 35 Plus
Dsim\GD22701-PA 3703 GD22701-PA 1737..2164 50..430 494 35.4 Plus
Dsim\GD22700-PA 3314 GD22700-PA 1997..2426 58..429 483 35.3 Plus
Dsim\GD22701-PA 3703 GD22701-PA 918..1276 66..433 477 36.8 Plus
Dsim\GD22701-PA 3703 GD22701-PA 15..398 74..408 475 34.8 Plus
Dsim\GD22700-PA 3314 GD22700-PA 2118..2530 72..428 472 34.7 Plus
Dsim\GD22701-PA 3703 GD22701-PA 614..1010 66..429 471 35.3 Plus
Dsim\GD22701-PA 3703 GD22701-PA 504..899 66..428 470 35.5 Plus
Dsim\GD22701-PA 3703 GD22701-PA 1862..2270 66..428 463 34.4 Plus
Dsim\GD22701-PA 3703 GD22701-PA 227..712 66..438 460 30.4 Plus
Dsim\GD22701-PA 3703 GD22701-PA 1079..1424 66..439 458 35.3 Plus
Dsim\GD22701-PA 3703 GD22701-PA 1523..1955 54..430 451 31.9 Plus
Dsim\GD22701-PA 3703 GD22701-PA 715..1168 66..428 443 31.7 Plus
Dsim\GD22700-PA 3314 GD22700-PA 2651..3063 66..438 425 31.6 Plus
Dsim\GD22701-PA 3703 GD22701-PA 72..486 19..428 418 32.8 Plus
Dsim\GD22700-PA 3314 GD22700-PA 2869..3296 66..433 412 30.9 Plus
Dsim\GD22700-PA 3314 GD22700-PA 1796..2214 66..435 409 33.1 Plus
Dsim\GD22701-PA 3703 GD22701-PA 18..316 137..429 386 35.9 Plus
Dsim\GD22700-PA 3314 GD22700-PA 1535..1993 66..429 383 30.3 Plus
Dsim\GD22701-PA 3703 GD22701-PA 2692..3103 71..436 379 32.2 Plus
Dsim\GD22701-PA 3703 GD22701-PA 2179..2599 66..438 360 31.2 Plus
Dsim\GD22701-PA 3703 GD22701-PA 2361..2783 58..429 344 32 Plus
Dsim\GD22700-PA 3314 GD22700-PA 2973..3312 72..343 312 30.5 Plus
Dsim\GD22700-PA 3314 GD22700-PA 3085..3293 54..264 310 38.6 Plus
Dsim\GD22701-PA 3703 GD22701-PA 2557..2979 69..432 303 31.6 Plus
Dsim\GD22701-PA 3703 GD22701-PA 2752..3174 70..438 300 31.4 Plus
Dsim\GD22701-PA 3703 GD22701-PA 16..210 236..428 263 36.3 Plus
Dsim\GD22700-PA 3314 GD22700-PA 1065..1419 66..423 258 31.4 Plus
Dsim\GD17480-PA 429 GD17480-PA 46..161 308..428 226 42.1 Plus
Dsim\GD22701-PA 3703 GD22701-PA 2876..3315 69..431 226 28 Plus
Dsim\GD22700-PA 3314 GD22700-PA 732..1173 54..431 203 28.2 Plus
Dsim\GD22701-PA 3703 GD22701-PA 2946..3325 71..382 200 29.7 Plus
Dsim\GD22700-PA 3314 GD22700-PA 899..1268 64..434 188 27.3 Plus
Dsim\GD22700-PA 3314 GD22700-PA 1024..1362 64..433 172 28.3 Plus
Dsim\GD17480-PA 429 GD17480-PA 72..161 232..321 170 46.2 Plus
Dsim\GD17480-PA 429 GD17480-PA 67..161 169..262 165 47.9 Plus
Dsim\GD22700-PA 3314 GD22700-PA 1167..1489 63..365 154 27.9 Plus
Dsim\GD22701-PA 3703 GD22701-PA 2993..3312 58..321 152 28.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18671-PA 388 GJ18671-PA 8..388 57..440 1811 90.9 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 3600..4016 63..428 585 36.3 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 10548..10969 66..435 577 37.4 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 5518..5939 66..438 577 37.7 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 10965..11396 57..436 564 35.5 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 4879..5304 66..438 563 36 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 4224..4656 49..429 551 35 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 10871..11290 63..435 550 37.2 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 3466..3924 31..440 548 33.7 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 2857..3278 58..431 548 35.5 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 4763..5188 55..428 544 36.1 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 2209..2646 55..437 544 36.1 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 8613..9046 51..436 538 35.8 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 2537..2960 57..432 536 36.7 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 3681..4127 32..436 533 34.8 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 7984..8409 66..440 533 35.6 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 4544..4978 43..435 530 34.4 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 3821..4227 66..428 530 34.5 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 1872..2312 32..429 530 35.2 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 4426..4877 32..440 530 34 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 8308..8730 65..440 524 34.5 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 3295..3703 70..436 522 35 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 1460..1894 55..436 520 34.2 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 6479..6899 66..440 520 33.9 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 8948..9372 66..428 519 34.3 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 3898..4335 32..430 519 34.9 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 5841..6256 66..439 519 35 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 6576..7006 46..437 514 35.4 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 6873..7314 32..431 510 34.5 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 711..1124 66..428 508 36.2 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 2743..3165 54..428 504 34.6 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 2441..2851 71..433 503 35.8 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 6247..6683 53..435 503 34.2 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 5206..5620 66..439 502 34.3 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 5701..6141 32..429 500 34.7 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 6153..6576 66..436 498 35.2 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 5097..5509 66..433 497 34 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 1142..1568 66..434 496 34.5 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 4029..4452 66..440 496 34 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 1993..2423 48..429 495 34.2 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 8389..8835 39..438 495 33.2 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 6368..6792 62..439 494 34.9 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 2653..3064 66..433 491 34.1 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 5595..6033 31..429 488 33.8 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 4965..5399 41..429 487 33.4 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 1795..2208 66..428 487 36.2 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 8830..9253 47..429 485 33.8 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 1029..1459 63..437 474 33.3 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 7219..7660 65..435 473 33 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 7773..8184 66..429 472 34.1 Plus
Dvir\GJ17388-PA 13499 GJ17388-PA 3184..3592 66..432 469 34.9 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 3413..3817 71..416 336 31.7 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 1147..1534 66..425 291 32.2 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 2295..2692 66..432 286 32.2 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 2466..2859 71..429 285 31.6 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 3264..3522 106..342 246 34.7 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 3501..3886 57..430 225 29.6 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 2755..3199 66..433 223 28.1 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 1436..1886 66..425 208 26.7 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 1648..2118 66..423 204 27.3 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 1106..1475 64..433 204 29.8 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 1780..2174 57..414 204 30.1 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 985..1335 67..415 201 26.6 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 814..1253 54..429 197 27.9 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 3138..3504 106..429 192 28.2 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 1881..2324 51..423 191 28.2 Plus
Dvir\GJ17387-PA 3915 GJ17387-PA 1249..1602 63..365 180 27.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16269-PA 951 GK16269-PA 514..951 1..440 2179 92.5 Plus
Dwil\GK23922-PA 3792 GK23922-PA 1160..1590 52..433 590 37.9 Plus
Dwil\GK23922-PA 3792 GK23922-PA 840..1266 54..432 550 36.3 Plus
Dwil\GK23922-PA 3792 GK23922-PA 1277..1695 66..432 539 36.3 Plus
Dwil\GK23922-PA 3792 GK23922-PA 713..1158 51..429 495 33.5 Plus
Dwil\GK23922-PA 3792 GK23922-PA 1603..1970 71..428 481 36.7 Plus
Dwil\GK23922-PA 3792 GK23922-PA 1493..1915 66..430 467 35 Plus
Dwil\GK23922-PA 3792 GK23922-PA 1066..1475 66..428 447 34.3 Plus
Dwil\GK23922-PA 3792 GK23922-PA 2780..3191 71..436 410 33.1 Plus
Dwil\GK23922-PA 3792 GK23922-PA 600..951 46..436 405 33.8 Plus
Dwil\GK23922-PA 3792 GK23922-PA 2193..2620 71..432 329 31 Plus
Dwil\GK23922-PA 3792 GK23922-PA 2586..3005 70..434 327 30.9 Plus
Dwil\GK23922-PA 3792 GK23922-PA 2639..3067 63..432 301 31 Plus
Dwil\GK23922-PA 3792 GK23922-PA 2152..2555 93..428 295 29.3 Plus
Dwil\GK23922-PA 3792 GK23922-PA 2916..3254 86..430 247 29.3 Plus
Dwil\GK23922-PA 3792 GK23922-PA 2984..3403 86..431 222 27.8 Plus
Dwil\GK23922-PA 3792 GK23922-PA 3034..3413 71..382 202 27.7 Plus
Dwil\GK23922-PA 3792 GK23922-PA 1878..2032 66..195 202 35.8 Plus
Dwil\GK23922-PA 3792 GK23922-PA 1835..2032 84..254 159 30.5 Plus
Dwil\GK23922-PA 3792 GK23922-PA 3081..3400 58..321 159 28.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15890-PA 442 GE15890-PA 14..442 13..440 2152 98.1 Plus
Dyak\GE14706-PA 5806 GE14706-PA 3802..4236 54..428 499 34.5 Plus
Dyak\GE14706-PA 5806 GE14706-PA 3412..3808 71..436 452 34.9 Plus
Dyak\GE14706-PA 5806 GE14706-PA 3707..4120 66..440 448 33 Plus
Dyak\GE14706-PA 5806 GE14706-PA 3473..3914 71..436 419 31.7 Plus
Dyak\GE14706-PA 5806 GE14706-PA 4795..5206 71..436 383 32.2 Plus
Dyak\GE14706-PA 5806 GE14706-PA 4464..4886 58..429 352 31.8 Plus
Dyak\GE14706-PA 5806 GE14706-PA 4597..4947 67..429 338 31.2 Plus
Dyak\GE14706-PA 5806 GE14706-PA 4207..4634 71..432 338 30.8 Plus
Dyak\GE14706-PA 5806 GE14706-PA 4141..4569 67..428 331 30 Plus
Dyak\GE14706-PA 5806 GE14706-PA 2294..2691 66..432 317 32.8 Plus
Dyak\GE14706-PA 5806 GE14706-PA 4855..5277 70..438 305 31.4 Plus
Dyak\GE14706-PA 5806 GE14706-PA 2465..2858 71..429 301 32.3 Plus
Dyak\GE14706-PA 5806 GE14706-PA 3971..4441 60..433 293 28.4 Plus
Dyak\GE14706-PA 5806 GE14706-PA 1148..1533 66..423 285 32.4 Plus
Dyak\GE14706-PA 5806 GE14706-PA 3263..3551 106..377 249 35.7 Plus
Dyak\GE14706-PA 5806 GE14706-PA 1437..1887 66..425 240 28.4 Plus
Dyak\GE14706-PA 5806 GE14706-PA 4979..5418 69..431 227 28 Plus
Dyak\GE14706-PA 5806 GE14706-PA 2089..2559 67..432 222 25.6 Plus
Dyak\GE14706-PA 5806 GE14706-PA 815..1256 54..431 207 28.4 Plus
Dyak\GE14706-PA 5806 GE14706-PA 1789..2117 65..423 207 29.2 Plus
Dyak\GE14706-PA 5806 GE14706-PA 2885..3198 106..433 207 29.6 Plus
Dyak\GE14706-PA 5806 GE14706-PA 1107..1476 64..433 202 30 Plus
Dyak\GE14706-PA 5806 GE14706-PA 1885..2323 53..423 193 27.3 Plus
Dyak\GE14706-PA 5806 GE14706-PA 2716..3117 68..415 189 27.5 Plus
Dyak\GE14706-PA 5806 GE14706-PA 2658..2947 174..437 186 29.9 Plus
Dyak\GE14706-PA 5806 GE14706-PA 1250..1603 63..365 171 26.8 Plus

GH07746.hyp Sequence

Translation from 110 to 1432

> GH07746.hyp
MQLLVVALVAVAIASLPQLAAGKKLGKRCVNCTYRTYYTYGDGRSLQRVV
YRDPVYTRAQSYASGCSGSPCGVNAVCQEASGGRPVCSCPPGFSGNPLTH
CNRGECLDNVDCRDNLQCKDNRCVNPCVGACGIGSNCDARNHVAVCSCPA
GYNGDPYHACHLNDPEEQCHPSPCGVNTKCEIINGVPTCSCVHGYVGNPL
SGCRHECDHDGDCSSRDMCSSNFKCVPACGQCGTGATCRTVSNHRAVCEC
PKGYIGSPYTECRPECYGDADCPAGRPACFYGICKNTCEGACGIGADCNL
RGLTPVCSCPRDMTGDPFVRCRPFTKEDLCDPNPCGTNAICVPGHDNTGR
ERPVCNCLPGHTGNPLSHCTRGECLSNNECPDHRACINYQCIDPCIGKCA
TGASCEPKAHLAVCRCPQGQSGDALVSCRQTRTFPVAKYH*

GH07746.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9572-PB 440 CG9572-PB 1..440 1..440 2574 100 Plus
CG9572-PA 441 CG9572-PA 3..441 2..440 2569 100 Plus
CG9572-PD 404 CG9572-PD 3..404 2..440 2314 91.6 Plus
dp-PZ 15998 CG33196-PZ 13030..13462 51..435 801 37.9 Plus
dp-PY 18095 CG33196-PY 15140..15559 66..435 799 38.1 Plus
dp-PZ 15998 CG33196-PZ 5698..6119 63..435 778 36.8 Plus
dp-PZ 15998 CG33196-PZ 12402..12824 66..436 774 36.6 Plus
dp-PZ 15998 CG33196-PZ 6553..6970 66..428 769 37.7 Plus
dp-PZ 15998 CG33196-PZ 8577..8992 66..429 765 36.8 Plus
dp-PZ 15998 CG33196-PZ 11126..11538 66..428 764 35.2 Plus
dp-PZ 15998 CG33196-PZ 6237..6645 66..429 758 36.3 Plus
dp-PZ 15998 CG33196-PZ 9852..10265 66..431 757 37 Plus
dp-PZ 15998 CG33196-PZ 7938..8353 66..428 753 35 Plus
dp-PZ 15998 CG33196-PZ 12727..13144 66..437 747 37.2 Plus
dp-PZ 15998 CG33196-PZ 13471..13890 66..432 744 36.3 Plus
dp-PZ 15998 CG33196-PZ 4946..5369 66..436 742 36.1 Plus
dp-PZ 15998 CG33196-PZ 7198..7609 66..428 742 37.2 Plus
dp-PZ 15998 CG33196-PZ 9071..9521 29..428 741 36 Plus
dp-PZ 15998 CG33196-PZ 8903..9312 66..435 738 35.2 Plus
dp-PZ 15998 CG33196-PZ 13367..13787 66..435 732 36.8 Plus
dp-PZ 15998 CG33196-PZ 7300..7723 66..438 731 33.9 Plus
dp-PZ 15998 CG33196-PZ 11450..11857 66..429 731 35.4 Plus
dp-PZ 15998 CG33196-PZ 13144..13562 59..428 730 36.5 Plus
dp-PZ 15998 CG33196-PZ 8157..8564 66..429 728 35.5 Plus
dp-PZ 15998 CG33196-PZ 4094..4519 66..440 726 34.9 Plus
dp-PZ 15998 CG33196-PZ 7377..7824 31..435 725 34.7 Plus
dp-PZ 15998 CG33196-PZ 9291..9740 32..436 725 34.6 Plus
dp-PZ 15998 CG33196-PZ 5375..5800 66..435 724 34.2 Plus
dp-PZ 15998 CG33196-PZ 10909..11323 62..428 724 35.5 Plus
dp-PZ 15998 CG33196-PZ 8784..9206 55..435 720 36.1 Plus
dp-PZ 15998 CG33196-PZ 9430..9842 66..432 720 36.3 Plus
dp-PZ 15998 CG33196-PZ 10382..10796 66..428 719 36.4 Plus
dp-PZ 15998 CG33196-PZ 6085..6540 19..428 717 33.7 Plus
dp-PZ 15998 CG33196-PZ 7832..8249 66..429 717 35 Plus
dp-PZ 15998 CG33196-PZ 4497..4932 42..428 713 34.4 Plus
dp-PZ 15998 CG33196-PZ 7627..8030 66..428 713 35.2 Plus
dp-PZ 15998 CG33196-PZ 4841..5258 66..435 712 35.7 Plus
dp-PZ 15998 CG33196-PZ 5594..6005 66..428 712 37 Plus
dp-PZ 15998 CG33196-PZ 5908..6328 60..428 711 36.9 Plus
dp-PZ 15998 CG33196-PZ 8016..8463 32..436 711 34.1 Plus
dp-PZ 15998 CG33196-PZ 11342..11751 66..430 709 36.4 Plus
dp-PZ 15998 CG33196-PZ 10174..10580 66..430 708 34.8 Plus
dp-PZ 15998 CG33196-PZ 12076..12498 54..432 706 33.8 Plus
dp-PZ 15998 CG33196-PZ 9540..9944 66..428 703 34.7 Plus
dp-PZ 15998 CG33196-PZ 10274..10684 66..428 700 36 Plus
dp-PZ 15998 CG33196-PZ 10486..10901 66..428 698 35 Plus
dp-PZ 15998 CG33196-PZ 5270..5695 66..436 697 35.7 Plus
dp-PZ 15998 CG33196-PZ 5476..5897 51..428 696 34.5 Plus
dp-PZ 15998 CG33196-PZ 13793..14171 66..435 695 37.7 Plus
dp-PZ 15998 CG33196-PZ 6986..7394 66..430 694 35.1 Plus
dp-PZ 15998 CG33196-PZ 12496..12923 50..430 693 36 Plus
dp-PZ 15998 CG33196-PZ 6648..7075 54..429 692 34 Plus
dp-PZ 15998 CG33196-PZ 6757..7179 54..428 692 35.3 Plus
dp-PZ 15998 CG33196-PZ 5052..5467 66..428 685 33.9 Plus