Clone GH08696 Report

Search the DGRC for GH08696

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:86
Well:96
Vector:pOT2
Associated Gene/TranscriptwupA-RC
Protein status:GH08696.pep: gold
Sequenced Size:939

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
wupA-RC 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

GH08696.complete Sequence

939 bp assembled on 2010-12-14

GenBank Submission: BT125851.1

> GH08696.complete
CGTTCAGTCTTTTTGTGTCGTTCAGTATCATCCGATTCGTGTGATCGACA
GCATAGCCGAATTTTTTTTCTTTTTTTTCTAATTCCTTGAAGTAACCAAA
AACACAAATCAAAATGGCTGATGATGAGGCTAAGAAGGCTAAACAGGCTG
AGATCGAGCGCAAGCGTGCTGAGGTGCGCAAGCGCATGGAGGAAGCCTCC
AAGGCCAAGAAGGCCAAGAAGGGTTTCATGACCCCAGAGAGGAAGAAGAA
ACTCAGGTTGCTGCTGCGTAAGAAAGCCGCTGAGGAGCTGAAGAAAGAAC
AGGAACGCAAAGCGGCTGAACGTAGACGCATCATCGAAGAACGTTGCGGC
AGTCCCAGGAATCTCAGCGATGCCAGCGAAGGCGAATTGCAAGAGATTTG
CGAAGAGTATTACGAGCGTATGTATATTTGTGAAGGCCAGAAATGGGATC
TGGAATACGAAGTCAGGAAAAAAGACTGGGAGATCAACGATCTCAATGCC
CAAGTTAACGATCTTCGCGGCAAGTTCGTCAAGCCAGCCCTGAAGAAGGT
CTCCAAATACGAAAACAAATTCGCCAAGCTGCAGAAGAAGGCCGCTGAGT
TCAACTTCCGCAACCAGCTCAAGGTGGTGAAGAAGAAGGAGTTCACGCTG
GAGGAGGAGGAGAAGGAGAAGAAACCCGACTGGTCCAAGGGCAAGCCCGG
AGATGCCAAGGTGAAGGAGGAGGTTGAGGCCGAAGCTTAAGTGTCCACAC
GTCCACTAGTGTCCACTGACCCGTGACTCCCGCCCTAAACAATAATTGAA
ATTATTTACAACAATTATCTGAAGCAATATAATTTATATGAATCTATTAA
TATATATATATATCCGCAAATATATATGCATGTATATATCTCGCCATATA
TATGTGTCCACAATGGAAAAAAAAAAAAAAAAAAAAAAA

GH08696.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17995098..17995347 916..667 1250 100 Minus
chrX 22417052 chrX 17995994..17996135 668..527 710 100 Minus
chrX 22417052 chrX 18002767..18002897 257..127 655 100 Minus
chrX 22417052 chrX 18002577..18002702 382..257 630 100 Minus
chrX 22417052 chrX 17998792..17998894 482..380 515 100 Minus
chrX 22417052 chrX 18006037..18006128 92..1 460 100 Minus
chrX 22417052 chrX 17996201..17996246 526..481 230 100 Minus
chrX 22417052 chrX 18003930..18003968 129..91 195 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-RF 627 CG7178-PF 1..627 114..740 3135 100 Plus
wupA-RC 627 CG7178-PC 1..627 114..740 3135 100 Plus
wupA-RG 810 CG7178-PG 196..810 126..740 3075 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-RC 1160 CG7178-RC 28..943 1..916 4580 100 Plus
wupA-RF 1129 CG7178-RF 87..912 91..916 4130 100 Plus
wupA-RG 1343 CG7178-RG 336..1126 126..916 3955 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-PF 208 CG7178-PF 21..197 174..704 561 100 Plus
wupA-PC 208 CG7178-PC 21..197 174..704 561 100 Plus
wupA-PG 269 CG7178-PG 82..258 174..704 561 100 Plus
wupA-PH 260 CG7178-PH 82..229 174..617 517 100 Plus
wupA-PE 208 CG7178-PE 21..197 174..704 450 89.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18105784..18106034 917..667 1255 100 Minus
X 23542271 X 18106681..18106822 668..527 710 100 Minus
X 23542271 X 18113447..18113577 257..127 655 100 Minus
X 23542271 X 18113257..18113382 382..257 630 100 Minus
X 23542271 X 18109470..18109572 482..380 515 100 Minus
X 23542271 X 18116707..18116798 92..1 460 100 Minus
X 23542271 X 18106888..18106933 526..481 230 100 Minus
X 23542271 X 18114610..18114648 129..91 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18113882..18114132 917..667 1255 100 Minus
X 23527363 X 18114779..18114920 668..527 710 100 Minus
X 23527363 X 18121545..18121675 257..127 655 100 Minus
X 23527363 X 18121355..18121480 382..257 630 100 Minus
X 23527363 X 18117568..18117670 482..380 515 100 Minus
X 23527363 X 18124805..18124896 92..1 460 100 Minus
X 23527363 X 18114986..18115031 526..481 230 100 Minus
X 23527363 X 18122708..18122746 129..91 195 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:39:50 has no hits.

GH08696.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:55:45 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18006037..18006128 1..92 100   Minus
chrX 18003931..18003966 93..128 100 <- Minus
chrX 18002767..18002895 129..257 100 <- Minus
chrX 18002578..18002701 258..381 100 <- Minus
chrX 17998792..17998892 382..482 100 <- Minus
chrX 17996201..17996244 483..526 100 <- Minus
chrX 17995994..17996135 527..668 100 <- Minus
chrX 17995191..17995345 669..823 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-14 18:27:27 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RF 1..627 114..740 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:36:34 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RC 1..627 114..740 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:55:45 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RC 1..627 114..740 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-14 18:27:27 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RC 25..940 1..916 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:36:34 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RC 28..943 1..916 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:55:45 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RC 28..943 1..916 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:55:45 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
X 18116707..18116798 1..92 100   Minus
X 18114611..18114646 93..128 100 <- Minus
X 18113447..18113575 129..257 100 <- Minus
X 18113258..18113381 258..381 100 <- Minus
X 18109470..18109570 382..482 100 <- Minus
X 18106888..18106931 483..526 100 <- Minus
X 18106681..18106822 527..668 100 <- Minus
X 18105785..18106032 669..916 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:36:34 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18010740..18010831 1..92 100   Minus
arm_X 18008644..18008679 93..128 100 <- Minus
arm_X 18007480..18007608 129..257 100 <- Minus
arm_X 18007291..18007414 258..381 100 <- Minus
arm_X 18003503..18003603 382..482 100 <- Minus
arm_X 18000921..18000964 483..526 100 <- Minus
arm_X 18000714..18000855 527..668 100 <- Minus
arm_X 17999818..18000065 669..916 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:53:10 Download gff for GH08696.complete
Subject Subject Range Query Range Percent Splice Strand
X 18124805..18124896 1..92 100   Minus
X 18122709..18122744 93..128 100 <- Minus
X 18121545..18121673 129..257 100 <- Minus
X 18121356..18121479 258..381 100 <- Minus
X 18117568..18117668 382..482 100 <- Minus
X 18114986..18115029 483..526 100 <- Minus
X 18114779..18114920 527..668 100 <- Minus
X 18113883..18114130 669..916 100 <- Minus

GH08696.pep Sequence

Translation from 113 to 739

> GH08696.pep
MADDEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLL
LRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYY
ERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYE
NKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKV
KEEVEAEA*

GH08696.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19521-PA 272 GF19521-PA 69..272 5..208 725 90.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18142-PA 269 GG18142-PA 66..269 5..208 728 90.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11970-PA 282 GH11970-PA 78..282 4..208 1028 99.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-PF 208 CG7178-PF 1..208 1..208 1063 100 Plus
wupA-PC 208 CG7178-PC 1..208 1..208 1063 100 Plus
wupA-PG 269 CG7178-PG 65..269 4..208 1044 99.5 Plus
wupA-PE 208 CG7178-PE 1..208 1..208 952 91.3 Plus
wupA-PD 208 CG7178-PD 1..208 1..208 952 91.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14711-PA 277 GI14711-PA 73..277 4..208 1027 99.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14173-PA 267 GL14173-PA 63..267 4..208 736 90.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\TpnI-PA 267 GA22383-PA 63..267 4..208 736 90.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22835-PA 224 GM22835-PA 66..224 5..208 509 67.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24482-PA 98 GD24482-PA 13..98 6..91 399 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\wupA-PA 274 GJ16776-PA 70..274 4..208 1022 99.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24919-PA 272 GK24919-PA 68..272 4..208 1024 99.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\wupA-PA 270 GE15552-PA 66..270 4..208 733 90.7 Plus

GH08696.hyp Sequence

Translation from 113 to 739

> GH08696.hyp
MADDEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLL
LRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYY
ERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYE
NKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKV
KEEVEAEA*

GH08696.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-PF 208 CG7178-PF 1..208 1..208 1063 100 Plus
wupA-PC 208 CG7178-PC 1..208 1..208 1063 100 Plus
wupA-PG 269 CG7178-PG 65..269 4..208 1044 99.5 Plus
wupA-PE 208 CG7178-PE 1..208 1..208 952 91.3 Plus
wupA-PD 208 CG7178-PD 1..208 1..208 952 91.3 Plus