Clone GH08712 Report

Search the DGRC for GH08712

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:87
Well:12
Vector:pOT2
Associated Gene/TranscriptSnr1-RA
Protein status:GH08712.pep: gold
Preliminary Size:2200
Sequenced Size:1353

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1064 2001-01-01 Release 2 assignment
CG1064 2001-12-12 Blastp of sequenced clone
CG1064 2003-01-01 Sim4 clustering to Release 3
Snr1 2008-04-29 Release 5.5 accounting
Snr1 2008-08-15 Release 5.9 accounting
Snr1 2008-12-18 5.12 accounting

Clone Sequence Records

GH08712.complete Sequence

1353 bp (1353 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070501

> GH08712.complete
TTTGTGTATGCGCCAAGAAAATTTAAGTCGCGGAATATTAACAAGGAATC
CCTGCCAGAAACAGGGCATTGAGAGACCACAGAAGAAAATATACCCAACA
TGGCACTGCAGACATACGGGGACAAGCCGGTGGCCTTCCAGCTGGAGGAG
GGCGGCGAGTACTACTACGTGGGCTCGGAAGTGGGCAACTACATGCGCCA
CTTCCGCGGCATTCTGTACAAGAAGTACCCGGGAATGACCCGCATCGTCC
TGTCCAACGAGGAGCGCAAGCGGCTGGCTGAGTCCGGCCTCAGCTCCCAC
ATCTTAGCCAGCTCTGTATCGCTGCTCCGCGCCGTAGAGGTGGATGATAT
CATGGCCGGCAACGATGAAAAGTATCGCGCCGTCTCCGTGAACACTTCCG
ATACGCCAGTGCCGCGGGAGAGCAAGTCAAAGAAGCAGCCACAGTATGTG
CCCACGATGCCGAACTCCAGCCACCTGGACGCAGTGCCACAGGCCACGCC
AATCAACCGAAACCGAGTGCACACGAAGAAGGTTCGCACATTCCCGATGT
GTTTCGACGACACGGATCCCACGGCTAGCCTGGAGAATGCGGCGCAGAAG
GAGTGCCTGGTGCCCATTCGACTGGACATGGAGCTAGAGGGTCAAAAGCT
GCGCGACACCTTCACGTGGAACAAGAACGAGAGCATGATTACTCCGGAGC
AGTTTGCCGAGGTGCTGTGCGACGACCTGGACCTCAATCCCCTGCCCTTT
GTGCCGGCTATTGCACAGGCCATCCGACAGCAGATCGAAGCCTTTCCCAA
CGATCCCCCCATCCTCGAGGAGACCTGCGACCAGCGGGTCATTGTTAAGC
TGAACATTCACGTGGGCAACACCTCGCTCGTCGACCAGGTCGAGTGGGAC
ATGTCCGAGAAGAACAACAACCCCGAGGAGTTTGCCATTAAACTCTGTGC
GGAATTGGGATTGGGAGGAGAGTTTGTTACGGCCATTGCCTACAGCATTA
GGGGTCAGCTATCGTGGCACTGTCGAACGTACGCCTTCAGCGAGGCCCCT
CTATCAACGATTGATGTGCCCTTCCGGAATCCCAGCGACGCTGACGCATG
GGCGCCATTCCTAGAGACGCTTACCGACGCCGAAATGGAGAAGAAAATCC
GCGACCAGGACCGCAACACGCGCAGAATGCGACGACTGGCCAATACCACA
ACTGGTTGGTGATCTTCCGCCGATCCAGCAATGTGTCACTAATGTAATCC
TCCTATTAAGTACCATTATGCATCCCAAATAAATGTGTGTCTGTCGATTT
TAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

GH08712.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-RA 1466 Snr1-RA 152..1456 1..1305 6525 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1297484..1298413 372..1301 4650 100 Plus
chr3R 27901430 chr3R 1296619..1296992 1..374 1870 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-RA 1113 CG1064-PA 1..1113 100..1212 5565 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:57 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-RA 1335 CG1064-RA 35..1335 1..1301 6505 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-PA 370 CG1064-PA 1..370 100..1209 1707 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5471825..5472758 372..1305 4670 100 Plus
3R 32079331 3R 5470960..5471333 1..374 1870 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5212656..5213589 372..1305 4670 100 Plus
3R 31820162 3R 5211791..5212164 1..374 1870 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:04:14 has no hits.

GH08712.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:24:17 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1297484..1298413 372..1301 100   Plus
chr3R 1296619..1296989 1..371 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:28:11 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 1..1113 100..1212 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:19:13 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 1..1113 100..1212 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:26:14 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 1..1113 100..1212 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:45:19 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 1..1113 100..1212 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:24:17 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 1..1113 100..1212 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:52:31 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 44..1344 1..1301 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:19:13 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 44..1344 1..1301 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:26:14 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 35..1335 1..1301 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:45:19 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 44..1344 1..1301 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:24:17 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 35..1335 1..1301 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:24:17 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5471825..5472754 372..1301 100   Plus
3R 5470960..5471330 1..371 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:26:14 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1297547..1298476 372..1301 100   Plus
arm_3R 1296682..1297052 1..371 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:21:43 Download gff for GH08712.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5212656..5213585 372..1301 100   Plus
3R 5211791..5212161 1..371 100 -> Plus

GH08712.pep Sequence

Translation from 99 to 1211

> GH08712.pep
MALQTYGDKPVAFQLEEGGEYYYVGSEVGNYMRHFRGILYKKYPGMTRIV
LSNEERKRLAESGLSSHILASSVSLLRAVEVDDIMAGNDEKYRAVSVNTS
DTPVPRESKSKKQPQYVPTMPNSSHLDAVPQATPINRNRVHTKKVRTFPM
CFDDTDPTASLENAAQKECLVPIRLDMELEGQKLRDTFTWNKNESMITPE
QFAEVLCDDLDLNPLPFVPAIAQAIRQQIEAFPNDPPILEETCDQRVIVK
LNIHVGNTSLVDQVEWDMSEKNNNPEEFAIKLCAELGLGGEFVTAIAYSI
RGQLSWHCRTYAFSEAPLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKI
RDQDRNTRRMRRLANTTTGW*

GH08712.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 00:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17254-PA 370 GF17254-PA 1..370 1..370 1996 99.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 00:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12837-PA 370 GG12837-PA 1..370 1..370 1999 99.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 00:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18597-PA 370 GH18597-PA 1..370 1..370 1992 99.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 00:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-PA 370 CG1064-PA 1..370 1..370 1942 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 00:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23079-PA 370 GI23079-PA 1..370 1..370 1996 99.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 00:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21665-PA 370 GL21665-PA 1..370 1..370 1996 99.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 00:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26364-PA 370 GA26364-PA 1..370 1..370 1996 99.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 00:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10810-PA 370 GM10810-PA 1..370 1..370 2003 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 00:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19788-PA 370 GD19788-PA 1..370 1..370 2003 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 00:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22699-PA 370 GJ22699-PA 1..370 1..370 1996 99.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 00:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11225-PA 369 GK11225-PA 1..369 1..370 1958 97.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 00:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25470-PA 370 GE25470-PA 1..370 1..370 1999 99.7 Plus

GH08712.hyp Sequence

Translation from 99 to 1211

> GH08712.hyp
MALQTYGDKPVAFQLEEGGEYYYVGSEVGNYMRHFRGILYKKYPGMTRIV
LSNEERKRLAESGLSSHILASSVSLLRAVEVDDIMAGNDEKYRAVSVNTS
DTPVPRESKSKKQPQYVPTMPNSSHLDAVPQATPINRNRVHTKKVRTFPM
CFDDTDPTASLENAAQKECLVPIRLDMELEGQKLRDTFTWNKNESMITPE
QFAEVLCDDLDLNPLPFVPAIAQAIRQQIEAFPNDPPILEETCDQRVIVK
LNIHVGNTSLVDQVEWDMSEKNNNPEEFAIKLCAELGLGGEFVTAIAYSI
RGQLSWHCRTYAFSEAPLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKI
RDQDRNTRRMRRLANTTTGW*

GH08712.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-PA 370 CG1064-PA 1..370 1..370 1942 100 Plus