Clone GH09086 Report

Search the DGRC for GH09086

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:90
Well:86
Vector:pOT2
Associated Gene/TranscriptRab6-RA
Protein status:GH09086.pep: gold
Preliminary Size:2200
Sequenced Size:1857

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6601 2001-01-01 Release 2 assignment
CG6601 2001-07-04 Blastp of sequenced clone
CG6601 2003-01-01 Sim4 clustering to Release 3
Rab6 2008-04-29 Release 5.5 accounting
Rab6 2008-08-15 Release 5.9 accounting
Rab6 2008-12-18 5.12 accounting

Clone Sequence Records

GH09086.complete Sequence

1857 bp (1857 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060261

> GH09086.complete
TCACACAGCAACTGACTCAGAAGTTAAAGAAGAAGAAGCAGAGACCGTAA
TTTTTCCACGACTCAACCTAGCGATTTACCAAGCCATTCGAGCCGCAATT
GAGTCTTTAGCCAGACGGAAAGCATTTAGAGCGTGTGTAATAGAGTGCGG
CAACTTGAAAGCGGTGCATCCCGAGAAATCGCAGTGCGAAAGGGCCCCGA
AAACCGCTGGCCCAGCCCCATTATAAACAGTGAGGAGGGGTGGAGATTGG
TGAGAGCGGAGCGGAGCGAGAAGAGAGTTCAGCAAACCCGTAATTAAGAA
AAAGTAGACACGTACGTTGAGGAAGATGTCATCCGGAGATTTTGGCAATC
CGCTGCGGAAGTTCAAGCTCGTCTTCCTCGGCGAGCAGAGTGTGGGCAAG
ACCTCGCTGATTACGCGCTTCATGTACGACAGCTTCGACAACACGTACCA
GGCGACGATCGGAATTGATTTCCTATCGAAGACCATGTACCTGGAGGATC
GCACTGTGCGCCTGCAGCTGTGGGATACGGCGGGACAGGAGCGATTCCGC
TCGCTGATACCCTCGTACATACGCGACTCCACGGTGGCAGTGGTCGTTTA
CGATATCACCAACACCAACTCGTTCCACCAGACCTCCAAGTGGATCGATG
ACGTGCGCACGGAGCGGGGTAGCGACGTCATCATCATGCTGGTGGGCAAC
AAGACGGATCTCTCCGACAAGCGTCAGGTGTCCACCGAGGAGGGTGAGCG
CAAGGCGAAGGAGCTTAACGTGATGTTCATCGAGACAAGCGCCAAGGCCG
GCTACAATGTGAAGCAATTGTTCCGACGGGTGGCCGCGGCACTGCCCGGC
ATGGATTCCACGGAGAACAAGCCCTCCGAGGACATGCAGGAGGTTGTGCT
AAAGGACTCACCCAACGAGACAAAGGATCCCGAGGGCGGCTGCGCCTGCT
AGAACCGGTTGAGCCGACGATCCAACCATCCTCTCCCCCTTTTTCAACAG
CAGGAGCAGATGCAGATGCAGGAGATCGGCCAGCAGCACTGGTGTACACA
GGTGTCAGGTGTATGTACTGGCCGGATCTGCGGCGGATTCCTCAACATCT
ATACACACATACACACTTTACGTTTAAGTTTATTTATAAAGTAACAAATG
ATAGCAAAGGCAAATAGACTAAACAACAATTAACGAAATCGGCTAACTAA
TTACTGTTAATTGACGAGCTAATCCCGAGCGCAGGCGAGTGCGAATGCTA
ACTCATTGACACGAGATCAGGGATCAAGATCAGAGTAATATTTGCGAGTT
AGCTACCAGACAAGAATATAGTGTAGTGCATTTCCGATACCCCCTAAACC
CTCTAAACGAAAAAAAACCCAAGACCATGTACTTATGTCAGGCCAGGCGG
TCCCAGGATCCTCCGACATTCCAGCTCTCGGCATCTCCAGCAGTCGTAGA
TACCACGCAGCCAGTCTGTGTTCAATGATTCCACCAGCCAGGCATTTTGT
TTCCAATTTTAGCCCCCGTTCTGTTCTGTTTGCGGCTTTTGTTTCGCCAG
TTTTGGTTAGGATTTCGGTTTTTTTTTTAGCACAGCGAACGCGACTGCTA
ACTGGAACTGTGGATGGCATAGGACTTGGCCACGTGCATCTTATGAATAA
ATATACACAAATATAAAATATGTATTTTTATGACTAAAACTGAAACAGAT
AAGCAGAGCACGAGCAGAGCAAACACTTAACAATATTATTAACGATTTTT
GCTTCGATTAGCGAGAGAACTTTGTGCATTTTTTACGCGAAAAGCAAAAG
CTTACAAAATTGATAATTGAATAAAAACATAAACTATTAAAAAAAAAAAA
AAAAAAA

GH09086.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-RA 1838 Rab6-RA 1..1838 1..1838 9190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12105948..12107785 1838..1 9145 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-RB 627 CG6601-PB 1..627 326..952 3135 100 Plus
Rab6-RA 627 CG6601-PA 1..627 326..952 3135 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:39:57 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-RB 1896 CG6601-RB 1..1830 9..1838 9150 100 Plus
Rab6-RA 1830 CG6601-RA 1..1830 9..1838 9150 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-PB 208 CG6601-PB 1..208 326..949 1067 100 Plus
Rab6-PA 208 CG6601-PA 1..208 326..949 1067 100 Plus
Rab10-PA 204 CG17060-PA 10..203 362..949 414 42.3 Plus
Rab5-PI 219 CG3664-PI 20..217 332..943 411 40.2 Plus
Rab5-PH 219 CG3664-PH 20..217 332..943 411 40.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12107287..12109124 1838..1 9190 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12107287..12109124 1838..1 9190 100 Minus
Blast to na_te.dros performed 2014-11-27 04:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
S2 1735 S2 S2 1735bp 1610..1661 1638..1689 116 69.2 Plus

GH09086.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:11:36 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12105948..12107785 1..1838 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:29:41 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..627 326..952 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:28:37 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..627 326..952 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:06 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..627 326..952 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:02:00 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..627 326..952 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:11:36 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..627 326..952 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:28:43 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..1838 1..1838 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:28:37 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..1838 1..1838 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:06 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..1830 9..1838 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:02:00 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..1838 1..1838 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:11:36 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..1830 9..1838 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:11:36 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12107287..12109124 1..1838 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:06 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12107287..12109124 1..1838 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:39:56 Download gff for GH09086.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12107287..12109124 1..1838 100   Minus

GH09086.pep Sequence

Translation from 325 to 951

> GH09086.pep
MSSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFL
SKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSF
HQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGERKAKELNVM
FIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNETK
DPEGGCAC*

GH09086.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23429-PA 208 GF23429-PA 1..208 1..208 1111 100 Plus
Dana\GF15280-PA 219 GF15280-PA 29..218 12..207 430 41.3 Plus
Dana\GF20241-PA 204 GF20241-PA 10..203 13..208 415 42.3 Plus
Dana\GF10843-PA 207 GF10843-PA 9..167 13..171 395 46.5 Plus
Dana\GF11093-PA 220 GF11093-PA 22..220 13..208 384 38.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10272-PA 208 GG10272-PA 1..208 1..208 1111 100 Plus
Dere\GG24527-PA 219 GG24527-PA 29..218 12..207 424 40.8 Plus
Dere\GG19277-PA 204 GG19277-PA 10..203 13..208 416 42.3 Plus
Dere\GG13365-PA 207 GG13365-PA 9..167 13..171 395 46.5 Plus
Dere\GG22724-PA 220 GG22724-PA 22..220 13..208 385 38.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10191-PA 208 GH10191-PA 1..208 1..208 1111 100 Plus
Dgri\GH13785-PA 216 GH13785-PA 28..215 12..207 417 40.8 Plus
Dgri\GH12621-PA 204 GH12621-PA 10..203 13..208 406 41.8 Plus
Dgri\GH16908-PA 207 GH16908-PA 9..167 13..171 396 46.5 Plus
Dgri\GH24197-PA 220 GH24197-PA 22..178 13..169 378 43.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-PB 208 CG6601-PB 1..208 1..208 1067 100 Plus
Rab6-PA 208 CG6601-PA 1..208 1..208 1067 100 Plus
Rab10-PA 204 CG17060-PA 10..203 13..208 414 42.3 Plus
Rab5-PI 219 CG3664-PI 20..217 3..206 411 40.2 Plus
Rab5-PH 219 CG3664-PH 20..217 3..206 411 40.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14260-PA 208 GI14260-PA 1..208 1..208 1106 99.5 Plus
Dmoj\GI17188-PA 216 GI17188-PA 28..215 12..207 419 41.3 Plus
Dmoj\GI11034-PA 204 GI11034-PA 10..203 13..208 404 42.3 Plus
Dmoj\GI13664-PA 207 GI13664-PA 9..167 13..171 395 46.5 Plus
Dmoj\GI20173-PA 220 GI20173-PA 22..220 13..208 387 38.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18897-PA 208 GL18897-PA 1..208 1..208 1111 100 Plus
Dper\GL19400-PA 218 GL19400-PA 28..217 12..207 427 41.3 Plus
Dper\GL15675-PA 207 GL15675-PA 9..167 13..171 393 46.5 Plus
Dper\GL17187-PA 220 GL17187-PA 22..220 13..208 384 38.3 Plus
Dper\GL27164-PA 205 GL27164-PA 12..205 13..207 372 36.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19714-PA 208 GA19714-PA 1..208 1..208 1111 100 Plus
Dpse\GA17598-PA 218 GA17598-PA 28..217 12..207 427 41.3 Plus
Dpse\GA26078-PA 204 GA26078-PA 10..203 13..208 404 41.8 Plus
Dpse\GA23499-PA 207 GA23499-PA 9..167 13..171 393 46.5 Plus
Dpse\GA20450-PA 220 GA20450-PA 22..220 13..208 384 38.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26307-PA 208 GM26307-PA 1..208 1..208 1111 100 Plus
Dsec\GM18235-PA 219 GM18235-PA 29..218 12..207 424 40.8 Plus
Dsec\GM23016-PA 204 GM23016-PA 10..203 13..208 416 42.3 Plus
Dsec\GM15893-PA 207 GM15893-PA 9..167 13..171 395 46.5 Plus
Dsec\GM20500-PA 220 GM20500-PA 22..220 13..208 385 38.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22841-PA 219 GD22841-PA 29..218 12..207 424 40.8 Plus
Dsim\GD12244-PA 207 GD12244-PA 9..167 13..171 395 46.5 Plus
Dsim\GD19996-PA 205 GD19996-PA 12..205 13..207 366 36.4 Plus
Dsim\GD15551-PA 201 GD15551-PA 9..200 13..208 362 39.1 Plus
Dsim\GD10420-PA 213 GD10420-PA 7..164 13..170 361 40.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20647-PA 208 GJ20647-PA 1..208 1..208 1111 100 Plus
Dvir\GJ22226-PA 216 GJ22226-PA 28..215 12..207 416 40.8 Plus
Dvir\GJ15815-PA 204 GJ15815-PA 10..203 13..208 409 42.3 Plus
Dvir\GJ13999-PA 207 GJ13999-PA 9..167 13..171 395 46.5 Plus
Dvir\GJ20130-PA 220 GJ20130-PA 22..178 13..169 378 43.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21078-PA 208 GK21078-PA 1..208 1..208 1107 99.5 Plus
Dwil\GK14984-PA 220 GK14984-PA 29..218 12..207 430 41.3 Plus
Dwil\GK25049-PA 204 GK25049-PA 10..203 13..208 408 42.3 Plus
Dwil\GK17214-PA 207 GK17214-PA 9..167 13..171 395 46.5 Plus
Dwil\GK19661-PA 220 GK19661-PA 22..220 13..208 384 38.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12402-PA 208 GE12402-PA 1..208 1..208 1111 100 Plus
Dyak\GE15124-PA 219 GE15124-PA 29..218 12..207 424 40.8 Plus
Dyak\GE17866-PA 204 GE17866-PA 10..203 13..208 416 42.3 Plus
Dyak\GE22459-PA 207 GE22459-PA 9..167 13..171 395 46.5 Plus
Dyak\GE13081-PA 220 GE13081-PA 22..220 13..208 385 38.3 Plus

GH09086.hyp Sequence

Translation from 325 to 951

> GH09086.hyp
MSSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFL
SKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSF
HQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGERKAKELNVM
FIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNETK
DPEGGCAC*

GH09086.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-PB 208 CG6601-PB 1..208 1..208 1067 100 Plus
Rab6-PA 208 CG6601-PA 1..208 1..208 1067 100 Plus
Rab10-PA 204 CG17060-PA 10..203 13..208 414 42.3 Plus
Rab5-PI 219 CG3664-PI 20..217 3..206 411 40.2 Plus
Rab5-PH 219 CG3664-PH 20..217 3..206 411 40.2 Plus