Clone GH09296 Report

Search the DGRC for GH09296

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:92
Well:96
Vector:pOT2
Associated Gene/Transcriptglob1-RE
Protein status:GH09296.pep: gold
Preliminary Size:1161
Sequenced Size:1014

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9734 2001-01-01 Release 2 assignment
CG9734 2001-11-29 Blastp of sequenced clone
glob1 2008-04-29 Release 5.5 accounting
glob1 2008-08-15 Release 5.9 accounting
glob1 2008-12-18 5.12 accounting

Clone Sequence Records

GH09296.complete Sequence

1014 bp (1014 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069075

> GH09296.complete
TCGTGTGCAGTTGCCTGGCATTTGATATAAACTCCTAAAAGCCATTAAGA
GAGGGCCGAACGCTTATAGAGAGCTATAGAGTGAAAGCTGAGAAGAACCA
AAACGGAGCATAAACATGAACAGCGATGAGGTGCAACTGATCAAGAAGAC
CTGGGAAATCCCCGTGGCAACACCAACAGATTCTGGAGCGGCGATACTGA
CGCAGTTTTTCAACCGCTTTCCGTCCAACTTGGAGAAGTTCCCCTTCCGC
GATGTTCCTTTGGAGGAGCTAAGTGTGAGTTGTACCTTACACATAGGTCT
TCAATTAACTCAAGATTAACTTGATCTGTTTTCTTTCAGGGAAATGCTCG
CTTCCGAGCACATGCCGGCAGAATCATAAGGGTCTTTGACGAGTCCATCC
AGGTCCTGGGCCAGGATGGCGATCTGGAGAAGCTGGACGAGATCTGGACC
AAAATTGCCGTTAGTCACATTCCGCGGACCGTTTCCAAGGAGTCTTACAA
CCAACTGAAAGGAGTTATCCTGGATGTGCTGACAGCTGCCTGCAGTCTGG
ACGAGAGTCAAGCGGCCACGTGGGCCAAGCTGGTGGACCATGTCTACGGA
ATCATCTTCAAGGCGATCGACGACGACGGCAACGCCAAGTAGATGAGGCA
GCTGGAGGTGGAGATGCAACCGAATCCGCGGAAGGATGCAACTGATGCCA
GCCGGTGGCACTTGCAACACATGCACAGCTTATGTAGTTCTAAGTAATTG
ATAAATGTTAGCTATTCTCGTTTTGTAATAATGAATGCGAATGTCCAAAA
CAAAAATACACACACAGTGAAAACTTATGTCTGCGTAGAGCTACTGACAC
ACGCGCACACCCCACACACATACACCCGCACTTGCATTGCTCTGTAAAGC
TTTAACCCATTGTCAGCCTTAAGCACTTGATAGCAAACAATACATGGAAT
CAGCAAAGGAGAAATAAGAAAGCTTATAAATAAAATCCAGTTTGAAAAAA
AAAAAAAAAAAAAA

GH09296.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-RE 1068 glob1-RE 30..1026 1..997 4985 100 Plus
glob1-RD 1145 glob1-RD 486..1143 340..997 3290 100 Plus
glob1.b 1140 glob1.b 480..1137 340..997 3290 100 Plus
glob1-RD 1145 glob1-RD 245..486 34..275 1210 100 Plus
glob1.b 1140 glob1.b 239..480 34..275 1210 100 Plus
glob1-RD 1145 glob1-RD 30..62 1..33 165 100 Plus
glob1.b 1140 glob1.b 24..56 1..33 165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11721512..11722004 994..502 2450 99.8 Minus
chr3R 27901430 chr3R 11722129..11722596 501..34 2340 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-RF 462 CG9734-PF 160..462 340..642 1515 100 Plus
glob1-RD 462 CG9734-PD 160..462 340..642 1515 100 Plus
glob1-RA 462 CG9734-PA 160..462 340..642 1515 100 Plus
glob1-RF 462 CG9734-PF 1..160 116..275 800 100 Plus
glob1-RD 462 CG9734-PD 1..160 116..275 800 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:40:25 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-RE 1021 CG9734-RE 28..1021 1..994 4970 100 Plus
glob1-RF 921 CG9734-RF 262..916 340..994 3275 100 Plus
glob1-RD 1143 CG9734-RD 484..1138 340..994 3275 100 Plus
glob1-RF 921 CG9734-RF 1..262 14..275 1310 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-PF 153 CG9734-PF 54..153 340..639 511 100 Plus
glob1-PD 153 CG9734-PD 54..153 340..639 511 100 Plus
glob1-PA 153 CG9734-PA 54..153 340..639 511 100 Plus
glob1-PB 153 CG9734-PB 54..153 340..639 511 100 Plus
glob1-PC 153 CG9734-PC 54..153 340..639 511 100 Plus
glob1-PF 153 CG9734-PF 1..53 116..274 275 100 Plus
glob1-PD 153 CG9734-PD 1..53 116..274 275 100 Plus
glob1-PA 153 CG9734-PA 1..53 116..274 275 100 Plus
glob1-PB 153 CG9734-PB 1..53 116..274 275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15896928..15897423 997..502 2480 100 Minus
3R 32079331 3R 15897548..15898015 501..34 2340 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15637759..15638254 997..502 2480 100 Minus
3R 31820162 3R 15638379..15638846 501..34 2340 100 Minus
3R 31820162 3R 15645333..15645365 33..1 165 100 Minus
3R 31820162 3R 15643274..15643306 33..1 165 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:45:23 has no hits.

GH09296.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:40:40 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11727022..11727054 1..33 100   Minus
chr3R 11722129..11722596 34..501 100 <- Minus
chr3R 11721512..11722004 502..994 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:30:25 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RA 160..462 340..642 100   Plus
glob1-RA 1..159 116..274 100 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:22:45 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RA 160..462 340..642 100   Plus
glob1-RA 1..159 116..274 100 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:55 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RB 160..462 340..642 100   Plus
glob1-RB 1..159 116..274 100 == Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:49:08 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RA 1..159 116..274 100 == Plus
glob1-RA 160..462 340..642 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:40:40 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RA 160..462 340..642 100   Plus
glob1-RA 1..159 116..274 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:57:35 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RD 245..485 34..274 100 == Plus
glob1-RD 486..1140 340..994 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:22:45 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RE 30..1023 1..994 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:55 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RE 30..1023 1..994 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:49:08 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RB 144..395 27..274 98 == Plus
glob1-RB 396..1050 340..994 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:40:40 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RE 28..1021 1..994 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:40:40 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15902443..15902475 1..33 100   Minus
3R 15897548..15898015 34..501 100 <- Minus
3R 15896931..15897423 502..994 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:55 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11728165..11728197 1..33 100   Minus
arm_3R 11723270..11723737 34..501 100 <- Minus
arm_3R 11722653..11723145 502..994 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:25:43 Download gff for GH09296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15643274..15643306 1..33 100   Minus
3R 15638379..15638846 34..501 100 <- Minus
3R 15637762..15638254 502..994 100 <- Minus

GH09296.pep Sequence

Translation from 115 to 318

> GH09296.pep
MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLE
ELSVSCTLHIGLQLTQD*

GH09296.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 02:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16470-PA 153 GF16470-PA 1..52 1..52 244 86.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 02:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20278-PA 153 GG20278-PA 1..53 1..53 272 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 02:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13816-PA 153 GH13816-PA 1..52 1..52 248 88.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-PE 67 CG9734-PE 1..67 1..67 348 100 Plus
glob1-PF 153 CG9734-PF 1..53 1..53 275 100 Plus
glob1-PD 153 CG9734-PD 1..53 1..53 275 100 Plus
glob1-PA 153 CG9734-PA 1..53 1..53 275 100 Plus
glob1-PB 153 CG9734-PB 1..53 1..53 275 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 02:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24641-PA 153 GI24641-PA 1..63 1..61 252 77.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 02:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21726-PA 154 GL21726-PA 1..53 1..53 259 90.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 02:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\glob1-PB 154 GA21995-PB 1..53 1..53 253 88.7 Plus
Dpse\glob1-PA 154 GA21995-PA 1..53 1..53 253 88.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 02:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25744-PA 153 GM25744-PA 1..53 1..53 277 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 02:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20318-PA 57 GD20318-PA 1..57 1..57 298 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 02:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\glob1-PA 153 GJ23463-PA 1..52 1..52 242 84.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 02:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11857-PA 153 GK11857-PA 1..53 1..53 262 92.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 02:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26348-PA 153 GE26348-PA 1..53 1..53 281 100 Plus

GH09296.hyp Sequence

Translation from 115 to 318

> GH09296.hyp
MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLE
ELSVSCTLHIGLQLTQD*

GH09296.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-PE 67 CG9734-PE 1..67 1..67 348 100 Plus
glob1-PF 153 CG9734-PF 1..53 1..53 275 100 Plus
glob1-PD 153 CG9734-PD 1..53 1..53 275 100 Plus
glob1-PA 153 CG9734-PA 1..53 1..53 275 100 Plus
glob1-PB 153 CG9734-PB 1..53 1..53 275 100 Plus