Clone GH09623 Report

Search the DGRC for GH09623

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:96
Well:23
Vector:pOT2
Associated Gene/TranscriptCG6330-RA
Protein status:GH09623.pep: gold
Preliminary Size:1166
Sequenced Size:1540

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6330 2001-01-01 Release 2 assignment
CG6330 2003-01-01 Sim4 clustering to Release 3
CG6330 2003-02-24 Blastp of sequenced clone
CG6330 2008-04-29 Release 5.5 accounting
CG6330 2008-08-15 Release 5.9 accounting
CG6330 2008-12-18 5.12 accounting

Clone Sequence Records

GH09623.complete Sequence

1540 bp (1540 high quality bases) assembled on 2003-02-24

GenBank Submission: BT004884

> GH09623.complete
CGTTGACGTGTCTACACGAGTAACTAGTTTTGTTTTGGCTCGCTGGCTGC
TCCTTCGTCTGGTAGTTGGTAGTTCGTTTGTGAGTTAAAGGACATTCGAG
AGGTGACATCATGCCGCCCACCATAACCGATAATCAGACGCACGACTTTA
AGGCCCACTACGATTGCGCCCACAGGTCCTCGCTGCAGGACGACGAGACG
GACGATGCGTACGTGAAAAGGATAACGCGGTACTCCGATGGAACCGTCAA
ATTGCGCAACTCGAACATTGAGCTCATGGACCAGGATATCCTCTATCACC
TGGCCTTGGGCAGCGAGAGCCACGACCTGCAGGAGATGTTTGGCGACGTT
AAGTTCGTTTGCATGGGCGGCACACCAAAGCGCATGGAGAATTTTGCCCA
TTTCATAATGAACGAGATTGGCTACAAGTTGCCAGCGGGCACCCAGCTGC
AGGACATCAGCGCCTATTCGTATCGCTACTCCATGTACAAAGTGGGACCG
GTGCTGTGCGTCAGCCATGGCATGGGTACGCCCTCGGTCAGCATCCTGAT
GCATGAGATGATCAAGCTGATGTACCACGCCAAGTGCAAGGATCCCGTCT
TCATCAGGATAGGAACGTGCGGAGGAATTGGCGTCGACGGCGGCACCGTC
ATCATCACCGAAGATGCCCTCGATGGGCAGCTGAGGAACTCCCATGAGTT
TACCATTCTCGGCAAGACCATCCATCGTCCTGCCAAGCTGGACAAAAAGC
TGGCCCGTGAGCTAAAGTCCCTGGCCAGTCCCGATGATCCGTACGATACC
ATTATTGGCAAGACGCTGTGCACCAACGATTTCTACGAGGGCCAGGGTCG
TTTGGACGGCGCATTCTGTGATTTCAGCGAGAACGAGAAGATGGCCTATC
TGGAGAAGCTGCGCGAGAACGGCGTGGTCAACATCGAGATGGAGAGCACC
ATCTTTGCGGCCCTGACCCACCATGCCGGCATCAAGGCAGCGGTGGTGTG
TGTCGCCCTGCTGAACCGCCTCAATGGGGATCAGGTCAACGCGCCCAAGG
AGGTCATGAACGAGTGGCAAGCGCGTCCGCAGATCCTCGTGTCGCGCTAT
ATTCGCAAGGTCCTTACGCACAATGGACAGCTGAAGGCGCTATTCGGACA
CCAGGGATCCATCAAGTCACCCCGGCGCTTCAAGCTCGTCCAGCAGGAGT
CTCAGGCCCACGAGTAAATGGGATCATGTGACCAGTTCCATCTCATTTCA
CCTTCTTACATTATATGTGCGCATCTCTCCAGTATACAATGATGTTTCAA
CATTCCCTAGTTTAGCTCTGATTAAGTTCCTAGCTTTATTTCTGTGTATA
TCGCCCACAACCTCATCGGATAATTTAAAACCGATCATATTGTACGTGCA
TATGTTCATATGTTACCACAATTTAATATATATATGTATATCAATAATAT
ATAAAAATAGTATCACTGAGTGTGACGTTCAAAGGTTATCAGAAATAAAC
GCTTTTGAGATCACAAAACAAAAAAAAAAAAAAAAAAAAA

GH09623.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RA 1925 CG6330-RA 129..1650 1..1522 7610 100 Plus
CG6330.a 2004 CG6330.a 45..1566 1..1522 7610 100 Plus
CG6330.b 2093 CG6330.b 363..1655 230..1522 6465 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22773161..22773607 1519..1073 2235 100 Minus
chr3R 27901430 chr3R 22773676..22774047 1073..702 1815 99.2 Minus
chr3R 27901430 chr3R 22774110..22774466 701..345 1725 98.9 Minus
chr3R 27901430 chr3R 22776038..22776269 232..1 1160 100 Minus
chr3R 27901430 chr3R 22774813..22774937 353..229 625 100 Minus
chr2R 21145070 chr2R 18819267..18819443 655..479 360 80.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RA 1107 CG6330-PA 1..1107 111..1217 5535 100 Plus
CG6330-RB 1044 CG6330-PB 57..1044 230..1217 4940 100 Plus
CG3788-RB 1137 CG3788-PB 390..566 479..655 345 79.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:40:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RA 1541 CG6330-RA 23..1541 1..1519 7595 100 Plus
CG6330-RB 2075 CG6330-RB 355..1644 230..1519 6450 100 Plus
CG3788-RB 1758 CG3788-RB 928..1104 479..655 345 79.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PA 368 CG6330-PA 1..368 111..1214 1832 100 Plus
CG6330-PB 347 CG6330-PB 10..347 177..1214 1617 96 Plus
CG3788-PB 378 CG3788-PB 57..346 258..1124 847 59 Plus
CG3788-PA 378 CG3788-PA 57..346 258..1124 847 59 Plus
CG17224-PD 300 CG17224-PD 2..298 234..1115 613 45.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26950120..26950569 1522..1073 2250 100 Minus
3R 32079331 3R 26950638..26951009 1073..702 1860 100 Minus
3R 32079331 3R 26951072..26951428 701..345 1755 99.4 Minus
3R 32079331 3R 26953001..26953232 232..1 1160 100 Minus
3R 32079331 3R 26951775..26951899 353..229 625 100 Minus
2R 25286936 2R 22932746..22932922 655..479 345 79.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26690951..26691400 1522..1073 2250 100 Minus
3R 31820162 3R 26691469..26691840 1073..702 1860 100 Minus
3R 31820162 3R 26691903..26692259 701..345 1755 99.4 Minus
3R 31820162 3R 26693832..26694063 232..1 1160 100 Minus
3R 31820162 3R 26692606..26692730 353..229 625 100 Minus
2R 25260384 2R 22933945..22934121 655..479 345 79.6 Minus
Blast to na_te.dros performed on 2014-11-27 09:33:50 has no hits.

GH09623.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:23:59 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22776041..22776269 1..229 100   Minus
chr3R 22774813..22774936 230..353 100 <- Minus
chr3R 22774110..22774457 354..701 99 <- Minus
chr3R 22773676..22774047 702..1073 99 <- Minus
chr3R 22773161..22773606 1074..1519 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:31:17 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 1..1107 111..1217 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:48:30 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 1..1107 111..1217 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:09 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 1..1107 111..1217 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:39:55 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 1..1107 111..1217 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:23:59 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 1..1107 111..1217 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:00:54 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 21..1539 1..1519 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:48:30 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 21..1539 1..1519 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:09 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 23..1541 1..1519 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:39:55 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 21..1539 1..1519 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:23:59 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 23..1541 1..1519 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:23:59 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26953004..26953232 1..229 100   Minus
3R 26951775..26951898 230..353 100 <- Minus
3R 26951072..26951419 354..701 100 <- Minus
3R 26950638..26951009 702..1073 100 <- Minus
3R 26950123..26950568 1074..1519 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:09 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22778726..22778954 1..229 100   Minus
arm_3R 22777497..22777620 230..353 100 <- Minus
arm_3R 22776794..22777141 354..701 100 <- Minus
arm_3R 22776360..22776731 702..1073 100 <- Minus
arm_3R 22775845..22776290 1074..1519 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:16 Download gff for GH09623.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26693835..26694063 1..229 100   Minus
3R 26692606..26692729 230..353 100 <- Minus
3R 26691903..26692250 354..701 100 <- Minus
3R 26691469..26691840 702..1073 100 <- Minus
3R 26690954..26691399 1074..1519 100 <- Minus

GH09623.pep Sequence

Translation from 110 to 1216

> GH09623.pep
MPPTITDNQTHDFKAHYDCAHRSSLQDDETDDAYVKRITRYSDGTVKLRN
SNIELMDQDILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIM
NEIGYKLPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEM
IKLMYHAKCKDPVFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTIL
GKTIHRPAKLDKKLARELKSLASPDDPYDTIIGKTLCTNDFYEGQGRLDG
AFCDFSENEKMAYLEKLRENGVVNIEMESTIFAALTHHAGIKAAVVCVAL
LNRLNGDQVNAPKEVMNEWQARPQILVSRYIRKVLTHNGQLKALFGHQGS
IKSPRRFKLVQQESQAHE*

GH09623.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18559-PA 368 GF18559-PA 1..368 1..368 1814 94 Plus
Dana\GF11317-PA 383 GF11317-PA 60..346 50..335 934 57.5 Plus
Dana\GF18560-PA 300 GF18560-PA 3..297 44..335 658 45.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12162-PA 368 GG12162-PA 1..368 1..368 1964 98.1 Plus
Dere\GG20084-PA 378 GG20084-PA 57..346 50..338 948 57.9 Plus
Dere\GG24468-PA 308 GG24468-PA 14..306 46..335 707 45.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19373-PA 346 GH19373-PA 10..346 24..368 1694 90.4 Plus
Dgri\GH19384-PA 350 GH19384-PA 51..337 50..335 912 56.8 Plus
Dgri\GH19395-PA 301 GH19395-PA 7..301 46..337 732 45.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PA 368 CG6330-PA 1..368 1..368 1939 100 Plus
CG6330-PB 347 CG6330-PB 10..347 23..368 1724 96 Plus
CG3788-PB 378 CG3788-PB 57..346 50..338 928 59 Plus
CG3788-PA 378 CG3788-PA 57..346 50..338 928 59 Plus
CG17224-PD 300 CG17224-PD 2..298 42..335 693 45.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22212-PA 363 GI22212-PA 1..363 1..368 1749 89.2 Plus
Dmoj\GI22215-PA 360 GI22215-PA 54..340 50..335 933 57.1 Plus
Dmoj\GI22213-PA 297 GI22213-PA 5..296 47..335 704 45.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 22:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27259-PA 365 GL27259-PA 1..365 1..368 1825 91.3 Plus
Dper\GL23743-PA 373 GL23743-PA 53..344 43..333 914 55.1 Plus
Dper\GL25985-PA 256 GL25985-PA 1..243 100..342 737 54.5 Plus
Dper\GL27260-PA 297 GL27260-PA 5..295 46..335 712 44.7 Plus
Dper\GL25965-PA 223 GL25965-PA 73..218 45..191 452 55.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19516-PA 365 GA19516-PA 1..365 1..368 1825 91.3 Plus
Dpse\GA19516-PB 347 GA19516-PB 10..347 23..368 1677 89.9 Plus
Dpse\GA26722-PA 373 GA26722-PA 53..344 43..333 914 55.1 Plus
Dpse\GA23650-PA 377 GA23650-PA 63..353 45..335 885 54.8 Plus
Dpse\GA27021-PA 297 GA27021-PA 5..295 46..335 717 44.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 22:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10155-PA 347 GM10155-PA 7..347 20..368 1772 94.6 Plus
Dsec\GM15599-PA 378 GM15599-PA 57..346 50..338 964 59 Plus
Dsec\GM18176-PA 300 GM18176-PA 2..298 42..335 717 45.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 22:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18110-PA 347 GD18110-PA 7..347 20..368 1772 94.6 Plus
Dsim\GD25095-PA 378 GD25095-PA 57..346 50..338 966 59.3 Plus
Dsim\GD12000-PA 279 GD12000-PA 2..279 42..316 673 46.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24332-PA 346 GJ24332-PA 14..346 36..368 1641 89.8 Plus
Dvir\GJ24333-PA 343 GJ24333-PA 30..323 43..335 966 58.8 Plus
Dvir\GJ24335-PA 303 GJ24335-PA 1..283 56..335 782 50.5 Plus
Dvir\GJ24336-PA 299 GJ24336-PA 5..297 46..335 754 48.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 22:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11445-PA 368 GK11445-PA 1..368 1..368 1839 91.6 Plus
Dwil\GK15591-PA 371 GK15591-PA 52..345 43..335 907 55.1 Plus
Dwil\GK11446-PA 299 GK11446-PA 4..298 45..335 755 45.9 Plus
Dwil\GK11364-PA 363 GK11364-PA 55..344 46..335 727 47.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10606-PA 347 GE10606-PA 10..347 23..368 1686 95.1 Plus
Dyak\GE11621-PA 382 GE11621-PA 57..346 50..338 955 58.6 Plus
Dyak\GE14961-PA 300 GE14961-PA 2..298 42..335 712 44.8 Plus

GH09623.hyp Sequence

Translation from 110 to 1216

> GH09623.hyp
MPPTITDNQTHDFKAHYDCAHRSSLQDDETDDAYVKRITRYSDGTVKLRN
SNIELMDQDILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIM
NEIGYKLPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEM
IKLMYHAKCKDPVFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTIL
GKTIHRPAKLDKKLARELKSLASPDDPYDTIIGKTLCTNDFYEGQGRLDG
AFCDFSENEKMAYLEKLRENGVVNIEMESTIFAALTHHAGIKAAVVCVAL
LNRLNGDQVNAPKEVMNEWQARPQILVSRYIRKVLTHNGQLKALFGHQGS
IKSPRRFKLVQQESQAHE*

GH09623.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PA 368 CG6330-PA 1..368 1..368 1939 100 Plus
CG6330-PB 347 CG6330-PB 10..347 23..368 1724 96 Plus
CG3788-PB 378 CG3788-PB 57..346 50..338 928 59 Plus
CG3788-PA 378 CG3788-PA 57..346 50..338 928 59 Plus
CG17224-PD 300 CG17224-PD 2..298 42..335 693 45.2 Plus