Clone GH10050 Report

Search the DGRC for GH10050

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:100
Well:50
Vector:pOT2
Associated Gene/Transcriptcpa-RA
Protein status:GH10050.pep: gold
Preliminary Size:2200
Sequenced Size:1915

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10540 2001-01-01 Release 2 assignment
CG10540 2001-11-09 Blastp of sequenced clone
CG10540 2003-01-01 Sim4 clustering to Release 3
cpa 2008-04-29 Release 5.5 accounting
cpa 2008-08-15 Release 5.9 accounting
cpa 2008-12-18 5.12 accounting

Clone Sequence Records

GH10050.complete Sequence

1915 bp (1915 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069084

> GH10050.complete
TGAATCGAATCGTCATCGTCTTGGCCCATTAATTGCGGAGAAAAAAGATT
GCAGCGCCGAAAAAACGGTCAAGGAAGAGTTCCAGCGACACCGCAACTTC
CAACCACTCCACAAGAAGATCCCGTCGAAAGGTAGAACCCTAGGAACCGG
AGGGGAAACCAGACCAAACCAAACAACCGCCCAGCCCCGATTTCGTGAAT
CACCAGTGGAACTATGGAGCAGACACCGATCACCGATGCGGAGAAGGTGC
GCATCGTATCGGACTTCATCCTACATGCGCCGCCCGGCGAGTTCAACGAA
GTGTTCAACGATGTGCGGGAGCTCCTCAAGAATGACACTCTGCTAAAGGA
TGGGGCTAGCCACGCCTTCGCCCAATACAACAAGGACCAGCTGACTCCGG
TTCGCATCGAGGGCACCGATCATAACGCCATCATATCGGAACACAACGAT
CTGGGAAACGGTCGCTTCTACGACCCGCGCACAAAGCAAGCCTTCAAATA
CGACCACCTCCGAAAAGAGGCTTCCGACTACCAGGACGTAGAGGCAGATG
CCACTGCGGAGCCCTGGAGGGCGGCCCTCGACCTGGAGACGCTCGCCTAC
ACTGCCAGTCATTATAGACACGGGGTCAGCTCTGTTTTTGGAAAGGCGCA
GGGCAACCAGATCACCCTGACCATTTGCATCGAAGACCACCAGTTCCAGC
CGAAGAACTATTGGAATGGCCGATGGCGCTCCCAGTGGCATGTGACCTTC
CAGGCGGGCAGCGGAACCGCCGAACTGAAGGGTGTGCTCAAGGTGCAGGT
GCATTACTACGAGGACGGCAACGTCCAGCTGGTGTCCTCAAAGGAGTGCC
GCGAAAGCGTGGTGGTCAGCAACGAGCAGCAGGTGGCCAAGGAGGTGATC
CGTCTGATCGAGGACGCCGAGAATGAGTACCAGCTGGCCATTTCGGAGAA
CTATCAGACGATGTCGGACACGACATTCAAGGCAATGCGTCGCCAGTTGC
CCATCACCAGGACCAAGATCGACTGGAGCAAAATCGTCTCGTACAGCATT
GGCAAGGAACTGAAGACGCAATAAGACCAGGAGGTGCAAGCGGAAGAGGA
GCGGACACAGTCGACAAAGCGGCCCAATAGTCTTCCACTTGCCATGGCCA
AGCGAGCATAGGAACCGATCACCAGCATTAACACCACAGCATCCGAAACG
AAGTAGCAGGAATACGAGAAACGAGGGCGGCCAGGTGCAGGTGCCTGCCG
AAAAAGCAAATGTCTGTAATTGGCTATATACATACGAACATATACCTACT
TATATATATATATACGGCCTGTATTTATACTGTGTTATACAACGACGAAA
GTGCGTAAACATAACTACACATATATCGAGTACGATCGGAGACGATTTGA
TTGCAAGGATTTGGATGACTTTAGCCTGACGGTGAACGATGCACTGCCGC
CTCGTCTACGTCACGATCGCCACCAATTGTCGCCTTTATCGTTTAAGAAG
AGCATTAAACGCGGATTTTATCATGTCCTCTGACCTATGTATTATTCTAA
TTTTAAACGAATCAAGCTCGAGATCTGCGCTCTCGATGAGCCAGTCAATT
CTTCGTGTCTTTGAAGACCAACCAGCCGACTCTCGACTATTTTAAGTGGT
ATCATTAGGAGCACTCATTCAAGTTTTTCGCTTTCCCGATTGTTCACAAA
CCAACCACCTAGTATGAGCATGAATAATAACTATGCTAAACCACTGATCA
TTTTTGCCAGCTCTCCATTGACAAACAATAACTAAAGACTTTGATTTTAT
AAAAACAATAAATTTGTAATTAAAATAACATAACTATAAAACATTTAAGA
TTGCTTGAATTAGTCAAATTTAAAGAGAATAAACTAATTGAATCGGAAAA
AAAAAAAAAAAAAAA

GH10050.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-RA 2047 cpa-RA 150..2046 1..1897 9485 100 Plus
CG15653-RA 898 CG15653-RA 794..898 1897..1793 525 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16945044..16946316 624..1896 6215 99.2 Plus
chr2R 21145070 chr2R 16944242..16944696 1..455 2215 99.1 Plus
chr2R 21145070 chr2R 16944816..16944988 454..626 805 97.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-RA 861 CG10540-PA 1..861 214..1074 4305 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:41:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-RA 1918 CG10540-RA 23..1918 1..1896 9480 100 Plus
CG15653-RA 711 CG15653-RA 608..711 1896..1793 520 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-PA 286 CG10540-PA 1..286 214..1071 1500 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21058611..21059884 624..1897 6370 100 Plus
2R 25286936 2R 21057809..21058263 1..455 2275 100 Plus
2R 25286936 2R 21058383..21058555 454..626 865 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21059810..21061083 624..1897 6370 100 Plus
2R 25260384 2R 21059008..21059462 1..455 2275 100 Plus
2R 25260384 2R 21059582..21059754 454..626 865 100 Plus
Blast to na_te.dros performed 2014-11-27 00:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 243..334 1797..1886 122 60.9 Plus
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 1937..2033 1874..1777 117 61.6 Minus

GH10050.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:43:42 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16945045..16946316 625..1896 96   Plus
chr2R 16944817..16944986 455..624 97 -> Plus
chr2R 16944242..16944695 1..454 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:32:06 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 1..861 214..1074 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:32:01 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 1..861 214..1074 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:44:16 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 1..861 214..1074 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:59:42 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 1..861 214..1074 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:43:42 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 1..861 214..1074 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:10:38 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 19..1914 1..1896 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:32:01 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 39..1934 1..1896 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:44:16 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 23..1918 1..1896 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:59:42 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 19..1914 1..1896 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:43:42 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 23..1918 1..1896 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:43:42 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21058612..21059883 625..1896 100   Plus
2R 21058384..21058553 455..624 100 -> Plus
2R 21057809..21058262 1..454 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:44:16 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16946117..16947388 625..1896 100   Plus
arm_2R 16945889..16946058 455..624 100 -> Plus
arm_2R 16945314..16945767 1..454 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:36:15 Download gff for GH10050.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21059811..21061082 625..1896 100   Plus
2R 21059583..21059752 455..624 100 -> Plus
2R 21059008..21059461 1..454 100 -> Plus

GH10050.pep Sequence

Translation from 213 to 1073

> GH10050.pep
MEQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASH
AFAQYNKDQLTPVRIEGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLR
KEASDYQDVEADATAEPWRAALDLETLAYTASHYRHGVSSVFGKAQGNQI
TLTICIEDHQFQPKNYWNGRWRSQWHVTFQAGSGTAELKGVLKVQVHYYE
DGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTM
SDTTFKAMRRQLPITRTKIDWSKIVSYSIGKELKTQ*

GH10050.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11927-PA 286 GF11927-PA 1..286 1..286 1508 96.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22079-PA 286 GG22079-PA 1..286 1..286 1540 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20526-PA 286 GH20526-PA 1..286 1..286 1390 90.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-PA 286 CG10540-PA 1..286 1..286 1500 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18973-PA 286 GI18973-PA 1..286 1..286 1430 90.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10145-PA 286 GL10145-PA 1..286 1..286 1453 93 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10384-PA 286 GA10384-PA 1..286 1..286 1453 93 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15798-PA 286 GM15798-PA 1..286 1..286 1547 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11558-PA 286 GD11558-PA 1..286 1..286 1547 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22434-PA 286 GJ22434-PA 1..286 1..286 1464 92.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23266-PA 287 GK23266-PA 7..287 6..286 1449 93.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12160-PA 286 GE12160-PA 1..286 1..286 1540 99 Plus

GH10050.hyp Sequence

Translation from 213 to 1073

> GH10050.hyp
MEQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASH
AFAQYNKDQLTPVRIEGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLR
KEASDYQDVEADATAEPWRAALDLETLAYTASHYRHGVSSVFGKAQGNQI
TLTICIEDHQFQPKNYWNGRWRSQWHVTFQAGSGTAELKGVLKVQVHYYE
DGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTM
SDTTFKAMRRQLPITRTKIDWSKIVSYSIGKELKTQ*

GH10050.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-PA 286 CG10540-PA 1..286 1..286 1500 100 Plus