Clone GH11591 Report

Search the DGRC for GH11591

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:115
Well:91
Vector:pOT2
Associated Gene/Transcriptp53-RA
Protein status:GH11591.pep: gold
Preliminary Size:1628
Sequenced Size:1579

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10873 2001-01-01 Release 2 assignment
CG33336 2001-11-08 Blastp of sequenced clone
p53 2008-04-29 Release 5.5 accounting
p53 2008-08-15 Release 5.9 accounting
p53 2008-12-18 5.12 accounting

Clone Sequence Records

GH11591.complete Sequence

1579 bp (1579 high quality bases) assembled on 2001-11-08

GenBank Submission: AY069096

> GH11591.complete
GTGGCCACTACGATTCTGTAGTTTTTTGTTAGCGAATTTTTAATATTTAG
CCTCCTTCCCCAACAAGATCGCTTGATCAGATATAGCCGACTAAGATGTA
TATATCACAGCCAATGTCGTGGCACAAAGAAAGCACTGATTCCGAGGATG
ACTCCACGGAGGTCGATATCAAGGAGGATATTCCGAAAACGGTGGAGGTA
TCGGGATCGGAATTGACCACGGAACCCATGGCCTTCTTGCAGGGATTAAA
CTCCGGGAATCTGATGCAGTTCAGCCAGCAATCCGTGCTGCGCGAAATGA
TGCTGCAGGACATTCAGATCCAGGCGAACACGCTGCCCAAGCTAGAGAAT
CACAACATCGGTGGTTATTGCTTCAGCATGGTTCTGGATGAGCCGCCCAA
GTCTCTTTGGATGTACTCGATTCCGCTGAACAAGCTCTACATCCGGATGA
ACAAGGCCTTCAACGTGGACGTTCAGTTCAAGTCTAAAATGCCCATCCAA
CCACTTAATTTGCGTGTGTTCCTTTGCTTCTCCAATGATGTGAGTGCTCC
CGTGGTCCGCTGTCAAAATCACCTTAGCGTTGAGCCTTTGACGGCCAATA
ACGCAAAAATGCGCGAGAGCTTGCTGCGCAGCGAGAATCCCAACAGTGTA
TATTGTGGAAATGCTCAGGGCAAGGGAATTTCCGAGCGTTTTTCCGTTGT
AGTCCCCCTGAACATGAGCCGGTCTGTAACCCGCAGTGGGCTCACGCGCC
AGACCCTGGCCTTCAAGTTCGTCTGCCAAAACTCGTGTATCGGGCGAAAA
GAAACTTCCTTAGTCTTCTGCCTGGAGAAAGCATGCGGCGATATCGTGGG
ACAGCATGTTATACATGTTAAAATATGTACGTGCCCCAAGCGGGATCGCA
TCCAAGACGAACGCCAGCTCAATAGCAAGAAGCGCAAGTCCGTGCCGGAA
GCCGCCGAAGAAGATGAGCCGTCCAAGGTGCGTCGGTGCATTGCTATAAA
GACGGAGGACACGGAGAGCAATGATAGCCGAGACTGCGACGACTCCGCCG
CAGAGTGGAACGTGTCGCGGACACCGGATGGCGATTACCGTCTGGCTATT
ACGTGCCCCAATAAGGAATGGCTGCTGCAGAGCATCGAGGGCATGATTAA
GGAGGCGGCGGCTGAAGTCCTGCGCAATCCCAACCAAGAGAATCTACGTC
GCCATGCCAACAAATTGCTGAGCCTTAAGAAACGTGCCTACGAGCTGCCA
TGACTTCTGATCTGGTCGACAATCTCCCAGGTATCAGATACCTTTGAAAT
GTGTTGCATCTGTGGGGTATACTACATAGCTATTAGTATCTTAAGTTTGT
ATTAGTCCTTGTTCGTAAGGCGTTTAACGGTGATATTCCCCTTTTGGCAT
GTTCGATGGCCGAAAAGAAAACATTTTTATATTTTTGATAGTATACTGTT
GTTAACTGCAGTTCTATGTGACTACGTAACTTTTGTCTACCACAACAAAC
ATACTCTGTACAAAAAAGCCAAAAGTGAATTTATTAAAGAGTTGTCATAT
TTTGCAAACATAAAAAAAAAAAAAAAAAA

GH11591.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
p53-RA 1705 p53-RA 69..1630 1..1562 7810 100 Plus
p53-RC 2171 p53-RC 535..2096 1..1562 7810 100 Plus
p53-RB 1886 p53-RB 458..1886 133..1561 7145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18873456..18873851 1230..835 1980 100 Minus
chr3R 27901430 chr3R 18873066..18873396 1561..1231 1655 100 Minus
chr3R 27901430 chr3R 18874224..18874536 588..276 1505 98.7 Minus
chr3R 27901430 chr3R 18873913..18874159 835..589 1205 99.2 Minus
chr3R 27901430 chr3R 18876766..18876898 133..1 665 100 Minus
chr3R 27901430 chr3R 18876527..18876610 215..132 420 100 Minus
chr3R 27901430 chr3R 18876421..18876457 251..215 185 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
p53-RC 1158 CG33336-PC 1..1158 96..1253 5790 100 Plus
p53-RA 1158 CG33336-PA 1..1158 96..1253 5790 100 Plus
p53-RB 1488 CG33336-PB 368..1488 133..1253 5605 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:44:46 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
p53-RC 2095 CG33336-RC 535..2095 1..1561 7805 100 Plus
p53-RA 1577 CG33336-RA 17..1577 1..1561 7805 100 Plus
p53-RB 1870 CG33336-RB 442..1870 133..1561 7145 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
p53-PC 385 CG33336-PC 1..385 96..1250 1942 100 Plus
p53-PA 385 CG33336-PA 1..385 96..1250 1942 100 Plus
p53-PB 495 CG33336-PB 133..495 162..1250 1888 100 Plus
p53-PE 334 CG33336-PE 10..334 276..1250 1695 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23050047..23050442 1230..835 1980 100 Minus
3R 32079331 3R 23049656..23049987 1562..1231 1660 100 Minus
3R 32079331 3R 23050815..23051127 588..276 1565 100 Minus
3R 32079331 3R 23050504..23050750 835..589 1235 100 Minus
3R 32079331 3R 23053357..23053489 133..1 665 100 Minus
3R 32079331 3R 23053118..23053201 215..132 420 100 Minus
3R 32079331 3R 23053012..23053048 251..215 185 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22790878..22791273 1230..835 1980 100 Minus
3R 31820162 3R 22790487..22790818 1562..1231 1660 100 Minus
3R 31820162 3R 22791646..22791958 588..276 1565 100 Minus
3R 31820162 3R 22791335..22791581 835..589 1235 100 Minus
3R 31820162 3R 22794188..22794320 133..1 665 100 Minus
3R 31820162 3R 22793949..22794032 215..132 420 100 Minus
3R 31820162 3R 22793843..22793879 251..215 185 100 Minus
Blast to na_te.dros performed on 2014-11-27 09:57:08 has no hits.

GH11591.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:32:50 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18876766..18876898 1..133 100   Minus
chr3R 18876528..18876608 134..214 100 <- Minus
chr3R 18876421..18876457 215..251 100 <- Minus
chr3R 18876331..18876357 252..278 100 <- Minus
chr3R 18874224..18874533 279..588 98 <- Minus
chr3R 18873913..18874159 589..835 99 <- Minus
chr3R 18873456..18873850 836..1230 100 <- Minus
chr3R 18873066..18873396 1231..1561 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:35:48 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 1..1158 96..1253 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:34:53 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RC 1..1158 96..1253 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:16 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 1..1158 96..1253 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:02:28 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 1..1158 96..1253 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:32:50 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 1..1158 96..1253 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:14:38 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 1..1561 1..1561 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:34:53 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RC 535..2095 1..1561 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:16 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 17..1577 1..1561 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:02:28 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 1..1561 1..1561 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:50 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 17..1577 1..1561 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:32:50 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23053357..23053489 1..133 100   Minus
3R 23053119..23053199 134..214 100 <- Minus
3R 23053012..23053048 215..251 100 <- Minus
3R 23052922..23052948 252..278 100 <- Minus
3R 23050815..23051124 279..588 100 <- Minus
3R 23050504..23050750 589..835 100 <- Minus
3R 23050047..23050441 836..1230 100 <- Minus
3R 23049657..23049987 1231..1561 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:16 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18879079..18879211 1..133 100   Minus
arm_3R 18878841..18878921 134..214 100 <- Minus
arm_3R 18878734..18878770 215..251 100 <- Minus
arm_3R 18878644..18878670 252..278 100 <- Minus
arm_3R 18876537..18876846 279..588 100 <- Minus
arm_3R 18876226..18876472 589..835 100 <- Minus
arm_3R 18875769..18876163 836..1230 100 <- Minus
arm_3R 18875379..18875709 1231..1561 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:39:30 Download gff for GH11591.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22794188..22794320 1..133 100   Minus
3R 22793950..22794030 134..214 100 <- Minus
3R 22793843..22793879 215..251 100 <- Minus
3R 22793753..22793779 252..278 100 <- Minus
3R 22791646..22791955 279..588 100 <- Minus
3R 22791335..22791581 589..835 100 <- Minus
3R 22790878..22791272 836..1230 100 <- Minus
3R 22790488..22790818 1231..1561 100 <- Minus

GH11591.pep Sequence

Translation from 95 to 1252

> GH11591.pep
MYISQPMSWHKESTDSEDDSTEVDIKEDIPKTVEVSGSELTTEPMAFLQG
LNSGNLMQFSQQSVLREMMLQDIQIQANTLPKLENHNIGGYCFSMVLDEP
PKSLWMYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFLCFSNDVS
APVVRCQNHLSVEPLTANNAKMRESLLRSENPNSVYCGNAQGKGISERFS
VVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIGRKETSLVFCLEKACGDI
VGQHVIHVKICTCPKRDRIQDERQLNSKKRKSVPEAAEEDEPSKVRRCIA
IKTEDTESNDSRDCDDSAAEWNVSRTPDGDYRLAITCPNKEWLLQSIEGM
IKEAAAEVLRNPNQENLRRHANKLLSLKKRAYELP*

GH11591.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18271-PA 368 GF18271-PA 1..368 1..385 1232 63.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12467-PA 508 GG12467-PA 131..508 12..385 1689 84.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18203-PA 359 GH18203-PA 1..333 45..382 1089 62.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
p53-PC 385 CG33336-PC 1..385 1..385 2008 100 Plus
p53-PA 385 CG33336-PA 1..385 1..385 2008 100 Plus
p53-PB 495 CG33336-PB 122..495 12..385 1935 99.5 Plus
p53-PE 334 CG33336-PE 10..334 61..385 1695 99.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10763-PA 351 GI10763-PA 2..351 43..385 1166 65.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27356-PA 386 GL27356-PA 2..361 2..380 1284 65.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27050-PA 386 GA27050-PA 1..361 1..380 1283 65.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23598-PA 489 GM23598-PA 114..489 10..385 1820 91 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18411-PA 489 GD18411-PA 114..489 10..385 1832 91.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14364-PA 349 GJ14364-PA 1..347 43..382 1151 63.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11606-PA 377 GK11606-PA 1..371 1..380 1165 58.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23990-PA 507 GE23990-PA 116..507 10..385 1692 82.2 Plus

GH11591.hyp Sequence

Translation from 95 to 1252

> GH11591.hyp
MYISQPMSWHKESTDSEDDSTEVDIKEDIPKTVEVSGSELTTEPMAFLQG
LNSGNLMQFSQQSVLREMMLQDIQIQANTLPKLENHNIGGYCFSMVLDEP
PKSLWMYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFLCFSNDVS
APVVRCQNHLSVEPLTANNAKMRESLLRSENPNSVYCGNAQGKGISERFS
VVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIGRKETSLVFCLEKACGDI
VGQHVIHVKICTCPKRDRIQDERQLNSKKRKSVPEAAEEDEPSKVRRCIA
IKTEDTESNDSRDCDDSAAEWNVSRTPDGDYRLAITCPNKEWLLQSIEGM
IKEAAAEVLRNPNQENLRRHANKLLSLKKRAYELP*

GH11591.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
p53-PC 385 CG33336-PC 1..385 1..385 2008 100 Plus
p53-PA 385 CG33336-PA 1..385 1..385 2008 100 Plus
p53-PB 495 CG33336-PB 122..495 12..385 1935 99.5 Plus
p53-PE 334 CG33336-PE 10..334 61..385 1695 99.7 Plus