Clone GH12068 Report

Search the DGRC for GH12068

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:120
Well:68
Vector:pOT2
Associated Gene/TranscriptRpt5-RA
Protein status:GH12068.pep: gold
Preliminary Size:1773
Sequenced Size:1611

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10370 2001-01-01 Release 2 assignment
CG10370 2002-12-11 Blastp of sequenced clone
CG10370 2003-01-01 Sim4 clustering to Release 3
Tbp-1 2008-04-29 Release 5.5 accounting
Tbp-1 2008-08-15 Release 5.9 accounting
Tbp-1 2008-12-18 5.12 accounting

Clone Sequence Records

GH12068.complete Sequence

1611 bp (1611 high quality bases) assembled on 2002-12-11

GenBank Submission: AF160882

> GH12068.complete
AAATTTACAAGTCATCGACAGAGTGTTTGCCCAAAAAGATCGGCAATAAT
AGCATTTTAACAAAGAATTACATTCAGCAACGGCTAATCAACAATCGTAT
TAGACATGGCTCAGACTCTGGAGGATAAGTCAATCTGGGAGGACGGGGAG
GAGTCCCTGGGCGAGGAGGTGATGCGTATGTCCACCGATGAAATTGTGAG
CAGGACTCGCCTGATGGACAACGAGATCAAGATCATGAAGAGCGAAGTGA
TACGCATAACGCACGAGATTCAGGCGCAAAATGAGAAGATCAAGGACAAC
ACCGAAAAGATCAAGGTCAACAAGACACTGCCCTACCTGGTGTCCAATGT
AATAGAGCTGCTGGATGTGGATCCACAGGAGGAGGAGGACGACGGCTCCG
TCACCGTTCTGGACAACCAGCGAAAGGGCAAGTGCGCCGTCATCAAAACA
TCCACTCGACAGGCGTATTTCCTGCCCGTCATCGGCCTGGTTGATGCCGA
GAAACTGAAGCCAGGTGATCTGGTCGGAGTCAACAAAGACTCCTATTTGA
TCCTGGAAACCCTGCCGGCAGAGTATGATGCCCGCGTAAAAGCCATGGAA
GTGGACGAGCGACCTACAGAGCAGTACTCCGACATTGGAGGTTTGGACAA
GCAGATACAGGAGCTCATCGAGGCAGTGGTGCTGCCCATGACGCACAAGG
AGAAGTTCAAAAACCTTGGCATTCACCCACCCAAAGGTGTCCTTTTGTAC
GGCCCCCCTGGAACTGGCAAAACATTGCTGGCCCGTGCCTGCGCCGCTCA
GACAAAGTCCACCTTCCTCAAGCTGGCAGGTCCCCAGTTGGTGCAAATGT
TCATCGGTGATGGTGCCAAGCTGGTGCGCGATGCCTTCGCCTTGGCCAAG
GAGAAGGCGCCTGCCATTATCTTCATTGACGAGTTGGACGCCATTGGCAC
CAAGCGTTTCGATTCGGAGAAGGCCGGTGACCGTGAGGTCCAGCGAACTA
TGTTGGAGCTTCTTAATCAGCTCGATGGCTTCAGTTCCACTGCAGATATT
AAGGTGATTGCGGCCACCAATCGCGTAGACATTCTGGATCCTGCTCTGCT
GCGCTCTGGTCGTCTGGATCGTAAGATCGAGTTCCCACATCCCAACGAGG
AAGCCCGTGCCCGTATTATGCAGATTCACTCGCGTAAAATGAACGTTAGC
AATGATGTGAATTTCGAGGAATTGTCCCGATCCACGGATGACTTCAACGG
CGCCCAGTGCAAAGCCGTCTGTGTGGAAGCTGGTATGATCGCACTGCGTC
GCTCCGCCAATTCGGTTACGCACGAAGACTTCATGGACGCCATCATGGAA
GTGCAGGCGAAGAAGAAGGCTAATCTTAACTACTACGCTTAGACTAAAAA
TTTGCAGTTTAACTTCACATTGTCAGCTCCCATTAAAATAAACCATGGAA
ATGTAAAATTTTTCAGTTTCGATCTGAGTTGCCCCTTGAAGATCGCCTTT
AAAATAACATCGCAACGGCTCTTAAAAGTAACTAGAATGGGAGACGTACT
GAAATCAATACCCAACCTTTTTAAAATAAACAAAAATATATATCAAAAAA
AAAAAAAAAAA

GH12068.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-1-RA 1663 Tbp-1-RA 70..1663 1..1594 7970 100 Plus
Rpt3-RA 1606 Rpt3-RA 978..1105 893..1020 235 78.9 Plus
Rpt3R-RC 1453 Rpt3R-RC 521..592 625..696 165 81.9 Plus
Rpt3R-RC 1453 Rpt3R-RC 789..927 893..1031 155 74.1 Plus
Rpt3-RA 1606 Rpt3-RA 1134..1221 1049..1136 140 77.2 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19577178..19578031 735..1594 3875 97 Plus
chr3R 27901430 chr3R 19576700..19577125 314..739 2100 99.5 Plus
chr3R 27901430 chr3R 19576323..19576639 1..317 1585 100 Plus
chrX 22417052 chrX 11017434..11017677 893..1136 290 74.6 Plus
chrX 22417052 chrX 21182341..21182514 985..1158 285 77.6 Plus
chr3R 27901430 chr3R 26405033..26405203 1155..985 195 74.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-RA 1287 CG10370-PA 1..1287 106..1392 6435 100 Plus
Rpt3-RB 1242 CG16916-PB 743..986 893..1136 290 74.6 Plus
Rpt3-RA 1242 CG16916-PA 743..986 893..1136 290 74.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:45:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-RA 1627 CG10370-RA 34..1627 1..1594 7970 100 Plus
Rpt3-RB 1553 CG16916-RB 955..1198 893..1136 290 74.6 Plus
Rpt3-RA 1423 CG16916-RA 825..1068 893..1136 290 74.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-PA 428 CG10370-PA 1..428 106..1389 2156 100 Plus
Rpt2-PB 439 CG5289-PB 72..430 232..1368 909 47 Plus
Rpt2-PA 439 CG5289-PA 72..430 232..1368 909 47 Plus
Rpt6-PA 405 CG1489-PA 82..392 430..1362 812 51.8 Plus
Rpt3-PB 413 CG16916-PB 49..394 268..1332 804 44.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23753764..23754626 735..1597 4315 100 Plus
3R 32079331 3R 23753286..23753711 314..739 2130 100 Plus
3R 32079331 3R 23752909..23753225 1..317 1585 100 Plus
X 23542271 X 11126187..11126430 893..1136 290 74.6 Plus
X 23542271 X 21317184..21317357 985..1158 285 77.6 Plus
3R 32079331 3R 30582518..30582688 1155..985 195 74.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23494595..23495457 735..1597 4315 100 Plus
3R 31820162 3R 23494117..23494542 314..739 2130 100 Plus
3R 31820162 3R 23493740..23494056 1..317 1585 100 Plus
X 23527363 X 21302342..21302449 1051..1158 240 81.4 Plus
X 23527363 X 11134285..11134412 893..1020 235 78.9 Plus
3R 31820162 3R 9496473..9496544 696..625 165 81.9 Minus
3R 31820162 3R 9496090..9496228 1031..893 155 74.1 Minus
X 23527363 X 11134441..11134528 1049..1136 140 77.2 Plus
Blast to na_te.dros performed on 2014-11-27 12:00:37 has no hits.

GH12068.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:00:04 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19577865..19578031 1435..1594 94   Plus
chr3R 19577180..19577864 737..1421 99 == Plus
chr3R 19576702..19577122 316..736 99 -> Plus
chr3R 19576323..19576637 1..315 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:37:07 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-RA 1..1287 106..1392 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:00:20 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-RA 1..1287 106..1392 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:56:44 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 1..1287 106..1392 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:50:54 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-RA 1..1287 106..1392 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:00:04 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 1..1287 106..1392 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:17:33 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-RA 32..1625 1..1594 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:00:20 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-RA 32..1625 1..1594 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:56:44 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 34..1627 1..1594 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:50:54 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-RA 32..1625 1..1594 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:00:04 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 34..1627 1..1594 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:00:04 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23753766..23754623 737..1594 100   Plus
3R 23753288..23753708 316..736 100 -> Plus
3R 23752909..23753223 1..315 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:56:44 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19579488..19580345 737..1594 100   Plus
arm_3R 19579010..19579430 316..736 100 -> Plus
arm_3R 19578631..19578945 1..315 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:22:41 Download gff for GH12068.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23494597..23495454 737..1594 100   Plus
3R 23494119..23494539 316..736 100 -> Plus
3R 23493740..23494054 1..315 100 -> Plus

GH12068.pep Sequence

Translation from 105 to 1391

> GH12068.pep
MAQTLEDKSIWEDGEESLGEEVMRMSTDEIVSRTRLMDNEIKIMKSEVIR
ITHEIQAQNEKIKDNTEKIKVNKTLPYLVSNVIELLDVDPQEEEDDGSVT
VLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSYLIL
ETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEK
FKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFI
GDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTML
ELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEA
RARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRS
ANSVTHEDFMDAIMEVQAKKKANLNYYA*

GH12068.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16259-PA 428 GF16259-PA 1..428 1..428 2253 99.1 Plus
Dana\GF17023-PA 446 GF17023-PA 79..437 43..421 928 47 Plus
Dana\GF21725-PA 405 GF21725-PA 102..392 129..419 846 54.6 Plus
Dana\GF20295-PA 413 GF20295-PA 49..394 55..409 830 44.5 Plus
Dana\GF23322-PA 402 GF23322-PA 82..389 111..419 826 51.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11226-PA 428 GG11226-PA 1..428 1..428 2265 99.8 Plus
Dere\GG12390-PA 439 GG12390-PA 72..430 43..421 928 47 Plus
Dere\GG19719-PA 405 GG19719-PA 102..392 129..419 846 54.6 Plus
Dere\GG11925-PA 401 GG11925-PA 81..388 111..419 829 51.5 Plus
Dere\GG18392-PA 410 GG18392-PA 46..391 55..409 829 44.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23603-PA 428 GH23603-PA 1..428 1..428 2256 99.1 Plus
Dgri\GH19692-PA 439 GH19692-PA 72..430 43..421 927 47 Plus
Dgri\GH11847-PA 405 GH11847-PA 102..392 129..419 845 54.6 Plus
Dgri\GH24150-PA 408 GH24150-PA 44..389 55..409 828 44.5 Plus
Dgri\GH14249-PA 392 GH14249-PA 75..373 111..409 812 50.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-PA 428 CG10370-PA 1..428 1..428 2156 100 Plus
Rpt2-PB 439 CG5289-PB 72..430 43..421 909 47 Plus
Rpt2-PA 439 CG5289-PA 72..430 43..421 909 47 Plus
Rpt6-PA 405 CG1489-PA 82..392 109..419 812 51.8 Plus
Rpt3-PB 413 CG16916-PB 49..394 55..409 804 44.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10364-PA 428 GI10364-PA 1..428 1..428 2256 99.1 Plus
Dmoj\GI22277-PA 439 GI22277-PA 72..430 43..421 927 47 Plus
Dmoj\GI14329-PA 405 GI14329-PA 102..392 129..419 846 54.6 Plus
Dmoj\GI21710-PA 393 GI21710-PA 75..374 110..409 825 50 Plus
Dmoj\GI10644-PA 404 GI10644-PA 81..391 109..419 814 50.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23259-PA 428 GL23259-PA 1..428 1..428 2258 99.3 Plus
Dper\GL24166-PA 417 GL24166-PA 72..408 43..421 878 46.1 Plus
Dper\GL27100-PA 413 GL27100-PA 49..394 55..409 829 44.5 Plus
Dper\GL16409-PA 269 GL16409-PA 1..256 164..419 806 58.6 Plus
Dper\GL23235-PA 386 GL23235-PA 69..385 111..427 794 45.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10280-PA 428 GA10280-PA 1..428 1..428 2258 99.3 Plus
Dpse\GA18789-PA 439 GA18789-PA 72..430 43..421 928 47 Plus
Dpse\GA13327-PA 405 GA13327-PA 102..392 129..419 845 54.6 Plus
Dpse\GA14216-PA 413 GA14216-PA 49..394 55..409 829 44.5 Plus
Dpse\GA26607-PA 405 GA26607-PA 86..392 112..419 828 51.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26527-PA 428 GM26527-PA 1..428 1..428 2265 99.8 Plus
Dsec\GM23527-PA 439 GM23527-PA 72..430 43..421 928 47 Plus
Dsec\GM23074-PA 405 GM23074-PA 102..392 129..419 846 54.6 Plus
Dsec\GM12144-PA 400 GM12144-PA 80..387 111..419 825 51.1 Plus
Dsec\GM26216-PA 389 GM26216-PA 48..389 67..428 814 43.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21035-PA 428 GD21035-PA 1..428 1..428 2271 100 Plus
Dsim\GD18337-PA 439 GD18337-PA 72..430 43..421 928 47 Plus
Dsim\GD17527-PA 405 GD17527-PA 102..392 129..419 846 54.6 Plus
Dsim\GD16958-PA 400 GD16958-PA 80..387 111..419 824 51.1 Plus
Dsim\GD20762-PA 389 GD20762-PA 48..389 67..428 814 43.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22583-PA 428 GJ22583-PA 1..428 1..428 2256 99.1 Plus
Dvir\GJ24070-PA 444 GJ24070-PA 77..435 43..421 926 47 Plus
Dvir\GJ19383-PA 405 GJ19383-PA 102..392 129..419 845 54.6 Plus
Dvir\GJ15572-PA 408 GJ15572-PA 44..389 55..409 829 44.5 Plus
Dvir\GJ23001-PA 408 GJ23001-PA 85..395 109..419 813 50.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22416-PA 428 GK22416-PA 1..428 1..428 2249 98.8 Plus
Dwil\GK11948-PA 439 GK11948-PA 72..430 43..421 928 47 Plus
Dwil\GK16292-PA 405 GK16292-PA 102..392 129..419 845 54.6 Plus
Dwil\GK16371-PA 413 GK16371-PA 49..394 55..409 830 44.5 Plus
Dwil\GK11127-PA 389 GK11127-PA 39..370 47..409 808 43.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Tbp-1-PA 428 GE10392-PA 1..428 1..428 2271 100 Plus
Dyak\GE10845-PA 439 GE10845-PA 72..430 43..421 928 47 Plus
Dyak\GE17917-PA 405 GE17917-PA 102..392 129..419 846 54.6 Plus
Dyak\GE23375-PA 401 GE23375-PA 81..388 111..419 829 51.5 Plus
Dyak\GE15910-PA 413 GE15910-PA 49..394 55..409 829 44.5 Plus

GH12068.hyp Sequence

Translation from 105 to 1391

> GH12068.hyp
MAQTLEDKSIWEDGEESLGEEVMRMSTDEIVSRTRLMDNEIKIMKSEVIR
ITHEIQAQNEKIKDNTEKIKVNKTLPYLVSNVIELLDVDPQEEEDDGSVT
VLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSYLIL
ETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEK
FKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFI
GDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTML
ELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEA
RARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRS
ANSVTHEDFMDAIMEVQAKKKANLNYYA*

GH12068.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-PA 428 CG10370-PA 1..428 1..428 2156 100 Plus
Rpt2-PB 439 CG5289-PB 72..430 43..421 909 47 Plus
Rpt2-PA 439 CG5289-PA 72..430 43..421 909 47 Plus
Rpt6-PA 405 CG1489-PA 82..392 109..419 812 51.8 Plus
Rpt3-PB 413 CG16916-PB 49..394 55..409 804 44.5 Plus