Clone GH13039 Report

Search the DGRC for GH13039

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:130
Well:39
Vector:pOT2
Associated Gene/TranscriptgammaSnap1-RA
Protein status:GH13039.pep: gold
Preliminary Size:1207
Sequenced Size:1086

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3988 2001-01-01 Release 2 assignment
CG3988 2002-06-07 Blastp of sequenced clone
CG6208 2003-01-01 Sim4 clustering to Release 3
CG3988 2003-01-01 Sim4 clustering to Release 3
gammaSnap 2008-04-29 Release 5.5 accounting
gammaSnap 2008-08-15 Release 5.9 accounting
gammaSnap 2008-12-18 5.12 accounting

Clone Sequence Records

GH13039.complete Sequence

1086 bp (1086 high quality bases) assembled on 2002-06-07

GenBank Submission: AY119512

> GH13039.complete
CTAAACAAAAGTGGTTGAAAATGTCGGGAATCGCTGCCAAAAAGATTGCC
GAAGCGGAGGACCTGGTGAAGCAGGCCGAGAAGAGCTTGAAGTTGTCCAT
GCTGAAATGGGTTCCTGATTACGATAGTGCTGCGGATGAGTATTCCAAAG
CTGCCACTGCATATCGAATAGCTAAAAGTTATGATAAGAGCAAGGAGTGT
TTTCTGAAGGCAATCGACGCCTATAAAAACAACAAGTCTTGGTTCCATGC
TGCAAAGGCATACGAACAGATCATTTTGCTGTCAAAGGATGCCGATAAGC
TACACGAAGTTGAGGAATACGCCAACAAATCGGCGAGTTTGTATCAACAG
CACGGTTCCCCAGAGGCAGCCGCATCCGCCTTGGATAAAGCCGCCAAGTT
AACTGAATCCAAGCATCCTGACATGGCTTTGCGCTTCTATCAGCATGCTC
TAGAAGTCATAATGATCGAGGATTCCGTCCGTCAAGCAGCCGAGTATGCA
TCAAAAGTTTCCAGGATACTGGTCAAACTAAGGAGGTACGACGAAGCCAC
GAATGCGCTCAAAAAGGAGATCAGCTTGAATCAGCAAACGGAATCTTACG
GACAAATTGGACGCCTAGTTGTGGCCTTGGTGATGGTCCAACTGGCTCGC
GGGGATTCCGTGGAAGCCGAAAAGACCTTCAGGGAGTGGGGAAACTGCTG
CGAGCCAGAGGAAGTGTCCACACTGCAGACCCTTCTGCAAGCCTTCGATG
ACGAGGATCCCGAGTTAGCTGCTAGGATGCTGGCATCCCCATTCATACGA
CATATGGATGTTGAGTACGCTATTCTATCTAAAAACATTCCACTACCTCA
GGGTATACAGATGGAGAAGAAGGCTGGCGACACTGCTGCTGAAACCAACG
ACGCCGAGGACGAAGGTGGCTTGTGCTAAATTTCTTAATGTTCGGTCTGC
TTGTTAGTCAAAATATATTTATCGTTAATAATATCGCTTTTAACATATTA
TATTAACTGTTAAATACAAATTTCATCGCAATCGTTGTACTAATTAATAA
ATACTAAGATCAATACTAAAAAAAAAAAAAAAAAAA

GH13039.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap-RA 1276 gammaSnap-RA 40..1107 1..1068 5340 100 Plus
CG6208-RA 1002 CG6208-RA 632..812 653..833 290 77.3 Plus
CG6208-RA 1002 CG6208-RA 119..250 140..271 270 80.3 Plus
sei.b 3226 sei.b 116..161 891..846 230 100 Minus
CG6208-RA 1002 CG6208-RA 476..589 497..610 210 78.9 Plus
CG6208-RA 1002 CG6208-RA 363..410 384..431 165 89.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 01:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19933534..19933891 891..534 1775 99.7 Minus
chr2R 21145070 chr2R 19934096..19934292 464..268 955 99 Minus
chr2R 21145070 chr2R 19933175..19933351 1067..891 885 100 Minus
chr3R 27901430 chr3R 5946361..5947054 833..140 740 73.8 Minus
chr2R 21145070 chr2R 19934365..19934481 269..153 570 99.1 Minus
chr2R 21145070 chr2R 19934799..19934883 85..1 425 100 Minus
chr2R 21145070 chr2R 19933953..19934027 538..464 375 100 Minus
chr2R 21145070 chr2R 19934669..19934738 153..84 350 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-RA 909 CG3988-PA 1..909 21..929 4545 100 Plus
gammaSnap2-RA 852 CG6208-PA 93..786 140..833 725 73.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:48:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-RA 1117 CG3988-RA 51..1117 1..1067 5335 100 Plus
sei-RC 3197 CG3182-RC 137..384 781..534 1240 100 Minus
gammaSnap2-RA 1002 CG6208-RA 119..812 140..833 725 73.6 Plus
sei-RC 3197 CG3182-RC 446..520 538..464 375 100 Minus
sei-RC 3197 CG3182-RC 94..138 891..847 225 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 01:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-PA 302 CG3988-PA 1..302 21..926 1460 100 Plus
gammaSnap2-PA 283 CG6208-PA 1..282 21..890 932 67.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24047504..24047861 891..534 1790 100 Minus
2R 25286936 2R 24048066..24048262 464..268 985 100 Minus
2R 25286936 2R 24047144..24047321 1068..891 890 100 Minus
3R 32079331 3R 10120589..10121282 833..140 725 73.6 Minus
2R 25286936 2R 24048335..24048451 269..153 585 100 Minus
2R 25286936 2R 24048769..24048853 85..1 425 100 Minus
2R 25286936 2R 24047923..24047997 538..464 375 100 Minus
2R 25286936 2R 24048639..24048708 153..84 350 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24048703..24049060 891..534 1790 100 Minus
2R 25260384 2R 24049265..24049461 464..268 985 100 Minus
2R 25260384 2R 24048343..24048520 1068..891 890 100 Minus
2R 25260384 2R 24049534..24049650 269..153 585 100 Minus
2R 25260384 2R 24049968..24050052 85..1 425 100 Minus
2R 25260384 2R 24049122..24049196 538..464 375 100 Minus
2R 25260384 2R 24049838..24049907 153..84 350 100 Minus
3R 31820162 3R 9861420..9861600 833..653 290 77.3 Minus
3R 31820162 3R 9861982..9862113 271..140 270 80.3 Minus
3R 31820162 3R 9861643..9861756 610..497 210 78.9 Minus
3R 31820162 3R 9861822..9861869 431..384 165 89.5 Minus
Blast to na_te.dros performed on 2014-11-27 01:11:22 has no hits.

GH13039.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 02:01:54 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19934799..19934883 1..85 100   Minus
chr2R 19934669..19934736 86..153 100 <- Minus
chr2R 19934365..19934480 154..269 99 <- Minus
chr2R 19934096..19934290 270..464 98 <- Minus
chr2R 19933956..19934026 465..535 100 <- Minus
chr2R 19933535..19933889 536..890 99 <- Minus
chr2R 19933175..19933351 891..1067 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:39:33 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 1..909 21..929 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:27:51 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 1..909 21..929 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:39 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 1..909 21..929 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:19:09 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 1..909 21..929 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:01:54 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap1-RA 1..909 21..929 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:57:50 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 37..1103 1..1067 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:27:51 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 37..1103 1..1067 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:39 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 51..1117 1..1067 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:19:09 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 37..1103 1..1067 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:01:54 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap1-RA 51..1117 1..1067 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:01:54 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24048769..24048853 1..85 100   Minus
2R 24048639..24048706 86..153 100 <- Minus
2R 24048335..24048450 154..269 100 <- Minus
2R 24048066..24048260 270..464 100 <- Minus
2R 24047926..24047996 465..535 100 <- Minus
2R 24047505..24047859 536..890 100 <- Minus
2R 24047145..24047321 891..1067 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:39 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19936292..19936376 1..85 100   Minus
arm_2R 19936162..19936229 86..153 100 <- Minus
arm_2R 19935858..19935973 154..269 100 <- Minus
arm_2R 19935589..19935783 270..464 100 <- Minus
arm_2R 19935449..19935519 465..535 100 <- Minus
arm_2R 19935028..19935382 536..890 100 <- Minus
arm_2R 19934668..19934844 891..1067 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:51:44 Download gff for GH13039.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24049986..24050070 1..85 100   Minus
2R 24049856..24049923 86..153 100 <- Minus
2R 24049552..24049667 154..269 100 <- Minus
2R 24049283..24049477 270..464 100 <- Minus
2R 24049143..24049213 465..535 100 <- Minus
2R 24048722..24049076 536..890 100 <- Minus
2R 24048362..24048538 891..1067 100 <- Minus

GH13039.hyp Sequence

Translation from 2 to 928

> GH13039.hyp
KQKWLKMSGIAAKKIAEAEDLVKQAEKSLKLSMLKWVPDYDSAADEYSKA
ATAYRIAKSYDKSKECFLKAIDAYKNNKSWFHAAKAYEQIILLSKDADKL
HEVEEYANKSASLYQQHGSPEAAASALDKAAKLTESKHPDMALRFYQHAL
EVIMIEDSVRQAAEYASKVSRILVKLRRYDEATNALKKEISLNQQTESYG
QIGRLVVALVMVQLARGDSVEAEKTFREWGNCCEPEEVSTLQTLLQAFDD
EDPELAARMLASPFIRHMDVEYAILSKNIPLPQGIQMEKKAGDTAAETND
AEDEGGLC*

GH13039.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-PA 302 CG3988-PA 1..302 7..308 1524 100 Plus
gammaSnap2-PA 283 CG6208-PA 1..282 7..296 991 67.3 Plus

GH13039.pep Sequence

Translation from 20 to 928

> GH13039.pep
MSGIAAKKIAEAEDLVKQAEKSLKLSMLKWVPDYDSAADEYSKAATAYRI
AKSYDKSKECFLKAIDAYKNNKSWFHAAKAYEQIILLSKDADKLHEVEEY
ANKSASLYQQHGSPEAAASALDKAAKLTESKHPDMALRFYQHALEVIMIE
DSVRQAAEYASKVSRILVKLRRYDEATNALKKEISLNQQTESYGQIGRLV
VALVMVQLARGDSVEAEKTFREWGNCCEPEEVSTLQTLLQAFDDEDPELA
ARMLASPFIRHMDVEYAILSKNIPLPQGIQMEKKAGDTAAETNDAEDEGG
LC*

GH13039.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 00:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13483-PA 303 GF13483-PA 3..303 5..302 1363 89 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 00:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19958-PA 302 GG19958-PA 1..302 1..302 1580 99 Plus
Dere\GG17301-PA 283 GG17301-PA 1..279 1..287 954 66.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 00:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21332-PA 301 GH21332-PA 14..301 15..302 1137 74 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 00:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-PA 302 CG3988-PA 1..302 1..302 1524 100 Plus
gammaSnap2-PA 283 CG6208-PA 1..282 1..290 991 67.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 00:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20748-PA 305 GI20748-PA 3..305 4..302 1166 80.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 00:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10427-PA 300 GL10427-PA 3..300 5..302 1163 80.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 00:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18278-PA 302 GM18278-PA 1..302 1..302 1586 99.3 Plus
Dsec\GM26186-PA 282 GM26186-PA 1..281 1..290 1000 67.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 00:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24976-PA 302 GD24976-PA 1..302 1..302 1589 99.7 Plus
Dsim\GD20734-PA 213 GD20734-PA 1..213 1..222 704 66.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 00:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20485-PA 304 GJ20485-PA 2..304 3..302 1144 79.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 00:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21930-PA 300 GK21930-PA 3..300 5..302 1233 85.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 00:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11490-PA 302 GE11490-PA 1..302 1..302 1575 98.7 Plus
Dyak\GE24704-PA 283 GE24704-PA 1..282 1..290 938 65.3 Plus