Clone GH13089 Report

Search the DGRC for GH13089

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:130
Well:89
Vector:pOT2
Associated Gene/TranscriptE2f2-RA
Protein status:GH13089.pep: gold
Preliminary Size:1484
Sequenced Size:1502

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1071 2001-01-01 Release 2 assignment
CG1071 2001-11-12 Blastp of sequenced clone
CG1071 2003-01-01 Sim4 clustering to Release 3
E2f2 2008-04-29 Release 5.5 accounting
E2f2 2008-08-15 Release 5.9 accounting
E2f2 2008-12-18 5.12 accounting

Clone Sequence Records

GH13089.complete Sequence

1502 bp (1502 high quality bases) assembled on 2001-11-12

GenBank Submission: AY069118

> GH13089.complete
AAGAATAGAGGGAGAATGAAAAAAATGACATAAATGGCGGAAAGCAAACC
TAGCGCCAACATTCGTATTTTCGTTTAATTTTCGCTCCAAAGTGCAATTA
ATTCCGGCTTCTTGATCGCTGCATATTGAGTGCAGCCACGCAAAGAGTTA
CAAGGACAGGAGTATAGTCATCGAGTCGATTGCGGACCATGTACAAGCGC
AAAACCGCGAGTATTGTTAAAAGAGACAGCTCCGCAGCGGGCACCACCTC
CTCGGCTATGATGATGAAGGTGGATTCGGCTGAGACTTCGGTCCGGTCGC
AGAGCTACGAGTCTACACCCGTTAGCATGGACACATCACCGGATCCTCCA
ACGCCAATCAAGTCTCCGTCGAATTCACAATCGCAATCGCAGCCTGGACA
ACAGCGCTCCGTGGGCTCACTGGTCCTGCTCACACAGAAGTTTGTGGATC
TCGTGAAGGCCAACGAAGGATCCATCGACCTGAAAGCGGCAACCAAAATC
TTGGACGTACAGAAGCGCCGAATATACGATATTACCAATGTTTTAGAGGG
CATTGGACTAATTGATAAGGGCAGACACTGCTCCCTAGTGCGCTGGCGCG
GAGGGGGCTTTAACAATGCCAAGGACCAAGAGAACTACGACCTGGCACGT
AGCCGGACTAATCATTTGAAAATGTTGGAGGATGACCTAGACAGGCAACT
GGAGTATGCACAGCGCAATCTGCGCTACGTTATGCAGGATCCCTCGAATA
GGTCGTATGCATATGTGACACGTGATGATCTGCTGGACATCTTTGGAGAT
GATTCCGTATTCACAATACCTAATTATGACGAGGAAGTAGATATCAAGCG
TAATCATTACGAGCTGGCCGTGTCGCTGGACAATGGCAGCGCAATTGACA
TTCGCCTGGTGACGAACCAAGGAAAGAGTACTACAAATCCGCACGATGTG
GATGGGTTCTTTGACTATCACCGTCTGGACACGCCCTCACCCTCGACGTC
GTCGCACTCCAGCGAGGATGGTAACGCTCCAGCATGCGCGGGGAACGTGA
TCACCGACGAGCACGGTTACTCGTGCAATCCCGGGATGAAAGATGAGATG
AAACTTTTGGAGAACGAGCTGACGGCCAAGATAATCTTCCAAAATTATCT
GTCCGGTCATTCGCTGCGGCGATTTTATCCCGATGATCCGAATCTAGAAA
ACCCGCCGCTGCTGCAGCTGAATCCTCCGCAGGAAGACTTCAACTTTGCG
TTAAAAAGCGACGAAGGTATTTGCGAGCTGTTTGATGTTCAGTGCTCCTA
ACTGTGGAAGGGGATGTACACCTTAGGACTATAGCTACACTGCAACTGGC
CGCGTGCATTGTGCAAATATTTATGATTAGTACAATTTTGACTTTGGATT
TCTCTATATCGTCTAGAAATTTTTAATTAGTGTAATACCTTGTAATTTCG
CAAATAACAGCAAAACCAATAAATTCGTAAATGCAAAAAAAAAAAAAAAA
AA

GH13089.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-RA 1690 E2f2-RA 109..1593 1..1485 7425 100 Plus
E2f2.a 1519 E2f2.a 15..1496 1..1485 7355 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21154248..21154736 489..1 2430 99.8 Minus
chr2L 23010047 chr2L 21153151..21153490 1197..858 1700 100 Minus
chr2L 23010047 chr2L 21152798..21153086 1484..1196 1430 99.7 Minus
chr2L 23010047 chr2L 21153612..21153871 857..598 1300 100 Minus
chr2L 23010047 chr2L 21154077..21154187 598..488 555 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-RB 1113 CG1071-PB 1..1113 189..1301 5565 100 Plus
E2f2-RA 1113 CG1071-PA 1..1113 189..1301 5565 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:48:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-RB 2002 CG1071-RB 519..2002 1..1484 7420 100 Plus
E2f2-RA 1485 CG1071-RA 2..1485 1..1484 7420 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-PB 370 CG1071-PB 1..370 189..1298 1545 100 Plus
E2f2-PA 370 CG1071-PA 1..370 189..1298 1545 100 Plus
E2f1-PF 805 CG6376-PF 259..425 420..908 207 35.9 Plus
E2f1-PA 805 CG6376-PA 259..425 420..908 207 35.9 Plus
E2f1-PC 805 CG6376-PC 259..425 420..908 207 35.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21155743..21156231 489..1 2445 100 Minus
2L 23513712 2L 21154646..21154985 1197..858 1700 100 Minus
2L 23513712 2L 21154292..21154581 1485..1196 1450 100 Minus
2L 23513712 2L 21155107..21155366 857..598 1300 100 Minus
2L 23513712 2L 21155572..21155682 598..488 555 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21155743..21156231 489..1 2445 100 Minus
2L 23513712 2L 21154646..21154985 1197..858 1700 100 Minus
2L 23513712 2L 21154292..21154581 1485..1196 1450 100 Minus
2L 23513712 2L 21155107..21155366 857..598 1300 100 Minus
2L 23513712 2L 21155572..21155682 598..488 555 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:09:10 has no hits.

GH13089.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:36:46 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21154249..21154736 1..488 99   Minus
chr2L 21154077..21154186 489..598 100 <- Minus
chr2L 21153612..21153870 599..857 100 <- Minus
chr2L 21153151..21153490 858..1197 100 <- Minus
chr2L 21152798..21153084 1198..1484 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:39:38 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 1..1113 189..1301 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:28:01 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 1..1113 189..1301 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:04:56 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 1..1113 189..1301 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:55:37 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 1..1113 189..1301 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:36:46 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 1..1113 189..1301 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:05:01 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 15..1498 1..1484 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:28:01 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 15..1498 1..1484 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:04:56 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 2..1485 1..1484 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:55:37 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 15..1498 1..1484 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:36:46 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 2..1485 1..1484 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:36:46 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21155744..21156231 1..488 100   Minus
2L 21155572..21155681 489..598 100 <- Minus
2L 21155107..21155365 599..857 100 <- Minus
2L 21154646..21154985 858..1197 100 <- Minus
2L 21154293..21154579 1198..1484 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:04:56 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21155744..21156231 1..488 100   Minus
arm_2L 21155572..21155681 489..598 100 <- Minus
arm_2L 21155107..21155365 599..857 100 <- Minus
arm_2L 21154646..21154985 858..1197 100 <- Minus
arm_2L 21154293..21154579 1198..1484 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:31:41 Download gff for GH13089.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21155744..21156231 1..488 100   Minus
2L 21155572..21155681 489..598 100 <- Minus
2L 21155107..21155365 599..857 100 <- Minus
2L 21154646..21154985 858..1197 100 <- Minus
2L 21154293..21154579 1198..1484 100 <- Minus

GH13089.pep Sequence

Translation from 188 to 1300

> GH13089.pep
MYKRKTASIVKRDSSAAGTTSSAMMMKVDSAETSVRSQSYESTPVSMDTS
PDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLVKANEGSIDLKA
ATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRGGGFNNAKDQENY
DLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLD
IFGDDSVFTIPNYDEEVDIKRNHYELAVSLDNGSAIDIRLVTNQGKSTTN
PHDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEHGYSCNPGM
KDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPNLENPPLLQLNPPQED
FNFALKSDEGICELFDVQCS*

GH13089.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 02:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15156-PA 370 GF15156-PA 1..370 1..370 1486 78.8 Plus
Dana\GF17810-PA 802 GF17810-PA 253..392 73..210 223 39.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 02:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21521-PA 371 GG21521-PA 1..371 1..370 1708 94.6 Plus
Dere\GG14417-PA 786 GG14417-PA 251..389 73..210 210 39.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 02:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13220-PA 377 GH13220-PA 83..377 73..369 1187 76.8 Plus
Dgri\GH19495-PA 869 GH19495-PA 285..423 73..210 211 40.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-PB 370 CG1071-PB 1..370 1..370 1931 100 Plus
E2f2-PA 370 CG1071-PA 1..370 1..370 1931 100 Plus
E2f1-PF 805 CG6376-PF 229..425 44..240 222 34.3 Plus
E2f1-PA 805 CG6376-PA 229..425 44..240 222 34.3 Plus
E2f1-PC 805 CG6376-PC 229..425 44..240 222 34.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 02:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14521-PA 369 GI14521-PA 1..369 1..369 1209 67 Plus
Dmoj\GI23766-PA 811 GI23766-PA 249..387 73..210 218 40.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 02:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25864-PA 369 GL25864-PA 1..369 1..370 1385 74 Plus
Dper\GL21507-PA 822 GL21507-PA 255..393 73..210 212 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 02:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10512-PA 374 GA10512-PA 1..374 1..370 1431 75.6 Plus
Dpse\GA19549-PA 835 GA19549-PA 257..395 73..210 213 39.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 02:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23275-PA 369 GM23275-PA 1..369 1..370 1801 96.5 Plus
Dsec\GM11000-PA 796 GM11000-PA 249..387 73..210 212 39.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 02:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21651-PA 371 GD21651-PA 1..371 1..370 1740 97 Plus
Dsim\GD19970-PA 796 GD19970-PA 249..387 73..210 212 39.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 02:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16286-PA 369 GJ16286-PA 1..369 1..369 1279 68.1 Plus
Dvir\GJ23948-PA 826 GJ23948-PA 261..399 73..210 209 39.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 02:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21054-PA 379 GK21054-PA 1..379 1..370 1265 69.5 Plus
Dwil\GK12076-PA 906 GK12076-PA 300..440 71..210 221 39.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 02:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13001-PA 371 GE13001-PA 1..371 1..370 1745 93.5 Plus
Dyak\GE24969-PA 792 GE24969-PA 249..387 73..210 211 39.4 Plus

GH13089.hyp Sequence

Translation from 188 to 1300

> GH13089.hyp
MYKRKTASIVKRDSSAAGTTSSAMMMKVDSAETSVRSQSYESTPVSMDTS
PDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLVKANEGSIDLKA
ATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRGGGFNNAKDQENY
DLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLD
IFGDDSVFTIPNYDEEVDIKRNHYELAVSLDNGSAIDIRLVTNQGKSTTN
PHDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEHGYSCNPGM
KDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPNLENPPLLQLNPPQED
FNFALKSDEGICELFDVQCS*

GH13089.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-PB 370 CG1071-PB 1..370 1..370 1931 100 Plus
E2f2-PA 370 CG1071-PA 1..370 1..370 1931 100 Plus
E2f1-PF 805 CG6376-PF 229..425 44..240 222 34.3 Plus
E2f1-PA 805 CG6376-PA 229..425 44..240 222 34.3 Plus
E2f1-PC 805 CG6376-PC 229..425 44..240 222 34.3 Plus