Clone GH13672 Report

Search the DGRC for GH13672

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:136
Well:72
Vector:pOT2
Associated Gene/TranscriptCG8314-RA
Protein status:GH13672.pep: gold
Preliminary Size:1272
Sequenced Size:1276

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8314 2001-01-01 Release 2 assignment
CG8314 2001-09-19 Blastp of sequenced clone
CG8314 2003-01-01 Sim4 clustering to Release 3
CG8314 2008-04-29 Release 5.5 accounting
CG8314 2008-08-15 Release 5.9 accounting
CG8314 2008-12-18 5.12 accounting

Clone Sequence Records

GH13672.complete Sequence

1276 bp (1276 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058364

> GH13672.complete
CTTGCTTTGCGTTTGCTGTTTATCAAACGCCTTTTGGCTAATGGTCCGCA
GTCCGGTGGCGTTATCACGGAATTGACGAGGCCGATGCGTCACATGTGCG
TGGGCTGCATCCGGACACCATGAACTACTCGTACTCCGCGCTGTCGCCCG
GCGGTAGCGGAGGATTCGGTGGCGTTGACCAGCACAACCGATGTTGCGGA
AACAAGGCCTGGTGCGTCAAGGACATCTGCGGCATTGTGTGCGTAATCAT
GACCTGGCTGCTTATCCTGTTCGCCGAATTCGTGGTCATGCGGCTGATCC
TTCTGCCCAGCAACTATACCGTCTTCAGTACCATCAACATGATCATATTC
CAGGCACTCGCCTTCCTGGCCTTCGCCTCGCACATACGCACAATGCTCTC
GGATCCGGGCGCTGTACCGCGCGGAAATGCCACCAAGGAGATGATCGAGC
AGATGGGCTACCGCGAGGGTCAGATGTTCTACAAGTGCCCCAAGTGCTGC
AGTATCAAGCCGGAACGAGCTCATCACTGTTCCGTCTGCCAGCGCTGCAT
CCGCAAGATGGATCACCACTGTCCGTGGGTAAATAATTGCGTGGGCGAGA
ACAATCAAAAGTACTTTGTGCTCTTCACCTTCTATATCGCTTCGATCTCC
GTGCACACGCTCTTCCTGGTGCTCACCCAGTTCGCGGAGTGCGTGAAAAA
CGACTGGCGCACCTGCTCGCCGTACTCTCCGCCGGCCACTATATTCCTGC
TGCTTTTTCTCACCTTTGAGGGCCTTATGTTCGGCATATTCACCATCATC
ATGCTGGCCACTCAGCTGACGGCTATCCTAAACGATCAGACGGGCATCGA
ACAGCTGAAGAAGGAGGAGGCCCGCTGGGCGAAGAAATCGCGCCTCAAGA
GCATCCAGTCGGTGTTCGGACGCTTCTCGTTGGCCTGGTTTTCACCATTC
ACGGAGCCCTCGTGCCGCACAAGATTCAACTCGCACTTCTATTCAGTCTG
AGGGATGTGATTGGAATGCGTATTAGCTTAATCGAACAATACTAACCAAC
TAACAAACGTACAAGGCAACAAGTTGTCGCTACTTGTTGCGCCGCTGAGT
GCAATTTTGTATATTGCAATTGCTATTTTTCGATCAATTGTCAACTATAT
ATTTACTACAAATCGTGCATATGTATGTGTGTGTTTAGGCCTAAGCGAAG
GAATTAAATATCCATTTCCGTGGCCGGGTGAAGATGTGTACTTACCTGAC
AGCCCTACTAAAAAAAAAAAAAAAAA

GH13672.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-RA 1358 CG8314-RA 55..1316 1..1262 6310 100 Plus
CG5880-RA 1604 CG5880-RA 601..676 520..595 200 84.2 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11876952..11877369 1259..842 2090 100 Minus
chr2R 21145070 chr2R 11878127..11878534 408..1 2040 100 Minus
chr2R 21145070 chr2R 11877721..11877943 629..407 1115 100 Minus
chr2R 21145070 chr2R 11877438..11877651 843..630 1070 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-RA 882 CG8314-PA 1..882 120..1001 4410 100 Plus
CG5880-RA 1146 CG5880-PA 449..524 520..595 200 84.2 Plus
Dnz1-RA 831 CG6627-PA 339..440 515..616 180 78.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:49:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-RA 1280 CG8314-RA 22..1280 1..1259 6295 100 Plus
CG5880-RA 1526 CG5880-RA 587..662 520..595 200 84.2 Plus
Dnz1-RA 1949 CG6627-RA 705..806 515..616 180 78.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-PA 293 CG8314-PA 1..293 120..998 1490 100 Plus
Dnz1-PA 276 CG6627-PA 4..267 216..980 409 32.2 Plus
CG1407-PF 449 CG1407-PF 10..295 219..947 266 27.6 Plus
CG1407-PG 452 CG1407-PG 10..298 219..947 266 27.2 Plus
CG1407-PB 338 CG1407-PB 10..289 219..947 261 27 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15989680..15990100 1262..842 2105 100 Minus
2R 25286936 2R 15990858..15991265 408..1 2040 100 Minus
2R 25286936 2R 15990452..15990674 629..407 1115 100 Minus
2R 25286936 2R 15990169..15990382 843..630 1070 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15990879..15991299 1262..842 2105 100 Minus
2R 25260384 2R 15992057..15992464 408..1 2040 100 Minus
2R 25260384 2R 15991651..15991873 629..407 1115 100 Minus
2R 25260384 2R 15991368..15991581 843..630 1070 100 Minus
Blast to na_te.dros performed on 2014-11-26 18:32:55 has no hits.

GH13672.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:05:34 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11878128..11878534 1..407 100   Minus
chr2R 11877721..11877942 408..629 100 <- Minus
chr2R 11877439..11877651 630..842 100 <- Minus
chr2R 11876952..11877368 843..1259 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:40:40 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 1..882 120..1001 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:07:51 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 1..882 120..1001 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:27:42 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 1..882 120..1001 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:38:38 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 1..882 120..1001 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:05:34 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 1..882 120..1001 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:58:03 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 18..1276 1..1259 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:07:51 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 18..1276 1..1259 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:27:42 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 22..1280 1..1259 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:38:38 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 18..1276 1..1259 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:05:34 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 22..1280 1..1259 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:05:34 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15990859..15991265 1..407 100   Minus
2R 15990452..15990673 408..629 100 <- Minus
2R 15990170..15990382 630..842 100 <- Minus
2R 15989683..15990099 843..1259 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:27:42 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11878364..11878770 1..407 100   Minus
arm_2R 11877957..11878178 408..629 100 <- Minus
arm_2R 11877675..11877887 630..842 100 <- Minus
arm_2R 11877188..11877604 843..1259 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:16:00 Download gff for GH13672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15992058..15992464 1..407 100   Minus
2R 15991651..15991872 408..629 100 <- Minus
2R 15991369..15991581 630..842 100 <- Minus
2R 15990882..15991298 843..1259 100 <- Minus

GH13672.pep Sequence

Translation from 119 to 1000

> GH13672.pep
MNYSYSALSPGGSGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLIL
FAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVP
RGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHH
CPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCS
PYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEE
ARWAKKSRLKSIQSVFGRFSLAWFSPFTEPSCRTRFNSHFYSV*

GH13672.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13331-PA 295 GF13331-PA 1..295 1..293 1466 94.9 Plus
Dana\GF20610-PA 239 GF20610-PA 1..162 1..184 740 79 Plus
Dana\GF14058-PA 275 GF14058-PA 4..267 33..288 426 32.6 Plus
Dana\GF12009-PA 338 GF12009-PA 2..289 18..276 250 28.2 Plus
Dana\GF17953-PA 427 GF17953-PA 31..250 55..273 239 27 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22313-PA 293 GG22313-PA 1..293 1..293 1582 100 Plus
Dere\GG10348-PA 276 GG10348-PA 4..268 33..288 420 32.1 Plus
Dere\GG25240-PA 438 GG25240-PA 2..286 18..276 249 29.4 Plus
Dere\GG15033-PA 443 GG15033-PA 20..222 43..244 239 29.7 Plus
Dere\GG18872-PA 428 GG18872-PA 31..252 55..275 237 27.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19831-PA 290 GH19831-PA 1..290 1..293 1424 90.5 Plus
Dgri\GH13330-PA 278 GH13330-PA 4..249 33..268 432 35 Plus
Dgri\GH13870-PA 419 GH13870-PA 31..249 55..273 238 27.4 Plus
Dgri\GH20289-PA 470 GH20289-PA 132..287 123..276 234 36.6 Plus
Dgri\GH15638-PA 417 GH15638-PA 37..245 63..275 231 29.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-PA 293 CG8314-PA 1..293 1..293 1588 100 Plus
Dnz1-PA 276 CG6627-PA 4..267 33..287 424 32.2 Plus
CG1407-PF 449 CG1407-PF 10..295 34..276 269 27.6 Plus
CG1407-PG 452 CG1407-PG 10..298 34..276 269 27.2 Plus
CG1407-PE 440 CG1407-PE 10..286 34..276 266 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20419-PA 290 GI20419-PA 1..290 1..293 1427 90.5 Plus
Dmoj\GI17805-PA 277 GI17805-PA 4..269 33..288 450 33.5 Plus
Dmoj\GI17806-PA 265 GI17806-PA 4..254 33..285 442 34.4 Plus
Dmoj\GI19459-PA 373 GI19459-PA 131..286 123..276 245 36 Plus
Dmoj\GI12685-PA 413 GI12685-PA 22..249 48..273 239 29.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20650-PA 286 GL20650-PA 1..286 1..293 1461 92.2 Plus
Dper\GL19029-PA 275 GL19029-PA 4..267 33..288 431 32.6 Plus
Dper\GL11511-PA 338 GL11511-PA 2..258 18..252 245 27.5 Plus
Dper\GL27308-PA 426 GL27308-PA 31..251 55..274 236 27.3 Plus
Dper\GL17257-PA 341 GL17257-PA 160..277 123..245 220 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20978-PA 286 GA20978-PA 3..286 2..293 1468 93.2 Plus
Dpse\GA19735-PA 275 GA19735-PA 4..267 33..288 431 32.6 Plus
Dpse\GA24755-PA 338 GA24755-PA 2..258 18..252 245 27.5 Plus
Dpse\GA18728-PA 426 GA18728-PA 31..251 55..274 240 27.3 Plus
Dpse\GA24148-PA 341 GA24148-PA 160..277 123..245 222 39.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20103-PA 293 GM20103-PA 1..293 1..293 1577 99.7 Plus
Dsec\GM11347-PA 276 GM11347-PA 4..268 33..288 421 32.1 Plus
Dsec\GM20560-PA 440 GM20560-PA 2..286 18..276 249 28.2 Plus
Dsec\GM24887-PA 435 GM24887-PA 47..258 70..279 242 29.2 Plus
Dsec\GM24028-PA 427 GM24028-PA 33..250 57..273 235 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25579-PA 293 GD25579-PA 1..293 1..293 1574 99.7 Plus
Dsim\GD22217-PA 276 GD22217-PA 4..268 33..288 421 32.1 Plus
Dsim\GD26013-PA 440 GD26013-PA 2..286 18..276 249 28.2 Plus
Dsim\GD18828-PA 427 GD18828-PA 31..250 55..273 239 27 Plus
Dsim\GD12938-PA 418 GD12938-PA 42..258 65..279 233 28.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20091-PA 289 GJ20091-PA 1..289 1..293 1396 88.5 Plus
Dvir\GJ17630-PA 277 GJ17630-PA 4..269 33..288 446 34.5 Plus
Dvir\GJ12670-PA 421 GJ12670-PA 37..251 63..275 270 29.1 Plus
Dvir\GJ21210-PA 480 GJ21210-PA 10..286 34..276 245 28.5 Plus
Dvir\GJ24468-PA 425 GJ24468-PA 33..244 57..280 222 26 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22100-PA 291 GK22100-PA 3..291 2..293 1453 91.8 Plus
Dwil\GK18372-PA 275 GK18372-PA 4..267 33..288 431 33.7 Plus
Dwil\GK24311-PA 391 GK24311-PA 30..253 57..279 267 29.6 Plus
Dwil\GK14400-PA 422 GK14400-PA 31..273 55..293 239 25.7 Plus
Dwil\GK21953-PA 367 GK21953-PA 131..285 123..276 233 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14111-PA 293 GE14111-PA 1..293 1..293 1579 99.7 Plus
Dyak\GE13229-PA 276 GE13229-PA 4..268 33..288 421 32.1 Plus
Dyak\GE21863-PA 465 GE21863-PA 2..286 18..276 251 29.8 Plus
Dyak\GE21257-PA 441 GE21257-PA 34..222 57..244 244 30.8 Plus
Dyak\GE26189-PA 428 GE26189-PA 31..250 55..273 239 27 Plus

GH13672.hyp Sequence

Translation from 119 to 1000

> GH13672.hyp
MNYSYSALSPGGSGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLIL
FAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVP
RGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHH
CPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCS
PYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEE
ARWAKKSRLKSIQSVFGRFSLAWFSPFTEPSCRTRFNSHFYSV*

GH13672.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-PA 293 CG8314-PA 1..293 1..293 1588 100 Plus
Dnz1-PA 276 CG6627-PA 4..267 33..287 424 32.2 Plus
CG1407-PF 449 CG1407-PF 10..295 34..276 269 27.6 Plus
CG1407-PG 452 CG1407-PG 10..298 34..276 269 27.2 Plus
CG1407-PE 440 CG1407-PE 10..286 34..276 266 27.2 Plus