Clone GH13775 Report

Search the DGRC for GH13775

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:137
Well:75
Vector:pOT2
Associated Gene/Transcriptbun-RC
Protein status:GH13775.pep: gold
Preliminary Size:7048
Sequenced Size:1756

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5461 2001-01-01 Release 2 assignment
CG5461 2001-09-19 Blastp of sequenced clone
CG5461 2003-01-01 Sim4 clustering to Release 3
bun 2008-04-29 Release 5.5 accounting
bun 2008-08-15 Release 5.9 accounting
bun 2008-12-18 5.12 accounting

Clone Sequence Records

GH13775.complete Sequence

1756 bp (1756 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060295

> GH13775.complete
TACAACTTGCTACACGCCACATCGCCAACAAATATATAACTGGCAACAGT
TTTAATATATATAACAAAAGAAGAAAAAAAAAATACACTGCTAAAACAAT
TACTTTTTATACCAACTGAAAAAAAAAAACACTTTACAAAAGCCTACCAG
AGACTCGTGAATTACATTAATTCGTTACAAGCAGACGCAAAACACTCCAA
TCGCAGTAAATTCAATCGAGAAAAGCTCGAAAATATCACAAAAGCTCTGC
GCCGGTCTCGTAAATCTCAAAAAAAAGCTGAACAGCAAACTCAGTTATTG
CTAAACTTTTGCCATACAAACACATACAGCGCCGACGAGAAATCGCAAGT
AAAGAAGTGAAAATACTACATAAAATACAATATATAAAACCCAACTGTGA
TCCAACTGAAACTGATATACATAAATATACTTGAAAAGTGCAAGAGTGGG
AGAATAAAGTCAAAATCTCCGCAAAAGAAACCAAAAATTATTGATACACA
CAAAACCCAGTGAAAATCAAAAAATAAAAAAAAACCCAAAGCCAAATATG
ATGGGCACTATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGATTTG
GCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCTAATGCAAAAG
ATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAAGTG
CTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGAGCT
CGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACACTGCAGCAGC
TGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACGCCCGCCATTCAA
GCGGCACCGGCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGGTCAGGC
AGTTCAGCAGCAGGCCGCTGGAGCGGTAGCGGTAACGGGTGTGGCCACCA
GTCCAGCGTCCGCGGTGGTACCCACGAGCATTCCCAACGGCAGCGCCGAG
AACGGCAGCAGTGCAGTCGAGTCAGCAGCGGTATCGGTGGAGCAGCAGGT
GCAGCAGGTGACATCAGCAGCGGCAGCAGCAGCATCGGTAGTCACAGCCA
ATGGTCCCATGTCCTAAACAGTTGCTGCTGTGGCCCGAACACACAGTGTT
TGTTTTTTTTAAGGCGCCCACGCACCGTGGTGTGTGTGGGGGGAAATGAA
CGTTTTTAAGAATGAAAACCGTAATGTTAACTCAGCCGCAGTCTCTTTCT
TAGTCGGAGGAGGCGGGGCCGAGGAGAGCAGCGAAAGTATTAGGCCAATA
ACAACAAGAACAGCAATAGCAGCGCAGCGGCAGGCAGACTCACCCAAACA
TGTTAAGTTCGTGTTAGGTAGACTAGCCTGCTGTTAAGAATTGTTATGTT
GTTGCTGGCTGTTAATCTGCTGCAGCCGCCGTTTTGTTAATTTCTCGATT
GTGATATTTGTTTAACACACATACAGACCACCACACACACACACACTCAT
ACGCATTTACACACACATCCATACGAAATACACACACAAACACACAGATA
GACTGCACGCTAACAGCGGCTGCGGCTGGCGCTGTTAACGTCCGCTGTTA
ACTCGAAGCGAGTATAGGAGTTCTTTTAAATATCGCGCTGCTGCGCCTCC
ACATTTTTGTTTAATACCTTTTATTTTTGTTTACCCGTTTGTTTCCACGT
TGTTAACGCTACGAAAATAAAAACATAAGAATCATAAACAAAAAAAAAAA
AAAAAA

GH13775.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
bun.d 3560 bun.d 170..1911 1..1742 8710 100 Plus
bun.a 2401 bun.a 170..1911 1..1742 8710 100 Plus
bun.h 2329 bun.h 170..1911 1..1742 8710 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12455773..12456871 1739..650 5295 99 Minus
chr2L 23010047 chr2L 12459235..12459883 650..1 3200 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
bun-RP 3414 CG42281-PP 2771..3414 474..1117 3220 100 Plus
bun-RC 570 CG42281-PC 1..570 548..1117 2850 100 Plus
bun-RO 579 CG42281-PO 112..579 650..1117 2340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:49:52 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
bun-RC 1754 CG5461-RC 20..1754 1..1735 8675 100 Plus
bun-RP 5139 CG42281-RP 3317..4582 474..1739 6330 100 Plus
bun-RO 3490 CG42281-RO 807..1896 650..1739 5450 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
bun-PP 1137 CG42281-PP 924..1024 473..775 522 99 Plus
bun-PC 189 CG5461-PC 1..76 548..775 393 100 Plus
bun-PO 192 CG42281-PO 33..79 635..775 203 91.5 Plus
bun-PB 219 CG5461-PB 60..106 635..775 203 91.5 Plus
bun-PH 226 CG42281-PN 67..113 635..775 203 91.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12457131..12458223 1742..650 5465 100 Minus
2L 23513712 2L 12460588..12461237 650..1 3250 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12457131..12458223 1742..650 5465 100 Minus
2L 23513712 2L 12460588..12461237 650..1 3250 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:11:20 has no hits.

GH13775.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:52:31 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12459236..12459883 1..649 99   Minus
chr2L 12455773..12456871 650..1739 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:40:49 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RI 1..570 548..1117 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:07:54 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RC 1..570 548..1117 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:08 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RJ 2771..3414 474..1117 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:38:40 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RI 1..570 548..1117 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:52:31 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RP 2771..3414 474..1117 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:58:08 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RI 1..1739 1..1739 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:07:54 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RC 1..1735 1..1735 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:08 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RC 20..1754 1..1735 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:38:41 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RI 1..1739 1..1739 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:52:31 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RC 20..1754 1..1735 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:52:31 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12460589..12461237 1..649 100   Minus
2L 12457134..12458223 650..1739 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:08 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12460589..12461237 1..649 100   Minus
arm_2L 12457134..12458223 650..1739 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:16:03 Download gff for GH13775.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12460589..12461237 1..649 100   Minus
2L 12457134..12458223 650..1739 100 <- Minus

GH13775.pep Sequence

Translation from 547 to 1116

> GH13775.pep
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAPAVQSVVAPAAAGQAVQQQAAGAVAVTGVATSPASAVVPTSIPNGSA
ENGSSAVESAAVSVEQQVQQVTSAAAAAASVVTANGPMS*

GH13775.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15669-PA 203 GF15669-PA 1..203 1..189 485 65.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10256-PA 188 GG10256-PA 1..188 1..189 633 83.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11674-PA 174 GH11674-PA 1..174 1..189 426 59.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
bun-PC 189 CG5461-PC 1..189 1..189 921 100 Plus
bun-PP 1137 CG42281-PP 949..1137 1..189 921 100 Plus
bun-PO 192 CG42281-PO 33..192 30..189 731 97.5 Plus
bun-PB 219 CG5461-PB 60..219 30..189 731 97.5 Plus
bun-PH 226 CG42281-PN 67..226 30..189 731 97.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17119-PA 196 GI17119-PA 1..81 1..81 419 92.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18768-PA 200 GL18768-PA 1..200 1..189 490 70.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25789-PA 201 GA25789-PA 1..201 1..189 475 67.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26174-PA 194 GM26174-PA 1..194 1..189 710 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22116-PA 194 GD22116-PA 1..194 1..189 710 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16158-PA 201 GJ16158-PA 1..81 1..81 423 92.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14623-PA 201 GK14623-PA 1..81 1..81 451 98.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12250-PA 194 GE12250-PA 1..194 1..189 631 82.5 Plus

GH13775.hyp Sequence

Translation from 547 to 1116

> GH13775.hyp
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAPAVQSVVAPAAAGQAVQQQAAGAVAVTGVATSPASAVVPTSIPNGSA
ENGSSAVESAAVSVEQQVQQVTSAAAAAASVVTANGPMS*

GH13775.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
bun-PC 189 CG5461-PC 1..189 1..189 921 100 Plus
bun-PP 1137 CG42281-PP 949..1137 1..189 921 100 Plus
bun-PO 192 CG42281-PO 33..192 30..189 731 97.5 Plus
bun-PB 219 CG5461-PB 60..219 30..189 731 97.5 Plus
bun-PH 226 CG42281-PN 67..226 30..189 731 97.5 Plus