Clone GH13992 Report

Search the DGRC for GH13992

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:139
Well:92
Vector:pOT2
Associated Gene/Transcriptshrb-RA
Protein status:GH13992.pep: gold
Preliminary Size:1239
Sequenced Size:1269

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8055 2001-01-01 Release 2 assignment
CG8055 2003-01-13 Blastp of sequenced clone
shrb 2008-04-29 Release 5.5 accounting
shrb 2008-08-15 Release 5.9 accounting
shrb 2008-12-18 5.12 accounting

Clone Sequence Records

GH13992.complete Sequence

1269 bp (1269 high quality bases) assembled on 2003-01-13

GenBank Submission: AY069131

> GH13992.complete
TGACGCATACGAACAACAGCTCCCAGACAACCAAGAAACGCAATAGCAGA
AAAAAACTCACTTGTTCGCTAAATTCGGGTGAAAAAACAGATCAGCCAGG
ATGAGTTTCTTCGGGAAGATGTTCGGCGGCAAGAAGGAAGTGGCCCCCAC
CACCGGCGAGGCGATACAGAAGCTGCGCGAGACGGAGAACATGCTTATCA
AAAAGCAGGAGTTCCTGGAGGCCAAGATCGAGGACGAACTGAATATAGCC
CGCAAGAATGCGTCTAAAAACAAAAGAGTGGCCCTGCAAGCACTCAAGAA
AAAGAAGCGGCTGGAGAAGCAACTCCAGCAGATCGATGGCACCCTGTCCA
CAATCGAAATGCAGCGCGAGGCTCTGGAGAGCGCCAACACAAACACTGCC
GTCTTGACCACGATGAAGAATGCCGCGGATGCCCTCAAGAGAGCCCATCA
GAATATGGACGTGGACAAGGTGCACGACATGATGGATGACATTGCCGAGC
AGCAGGACGTGGCCCGCGAGATTTCCGATGCCATTTCGAACCCAGTGGCA
TTCGGCGCCGATCTGGATGATGAGGATCTCGAGCGGGAACTCGACGAGCT
GGAGCAGGAGAACTTTGATAAGGAAATCATTGGCATACCCGAGCCGACGC
CCACATTGCCAGAAGCACCCACAGAAGATTTGCCCGAGAAGGCCAAAGAA
AAGAAAAAGGCGACAACCACGACTGCCGTGGAGGATGATGATGATCCAGA
CATGAAGCAGCTTTTATCCTGGTCCAACTAAATCAGAGAGCTATTGAAAT
CTCCTTACTGTTCTGAAGATACACCCTATCGTTTTTGTTTAATTTAATAA
TCAATACTGCTGTTAATTAAGCAAAATTTTAGTTCGAAGCGAGGGAGAGA
ATACAAGGCATTAATTCCTTTGGCAATTCAACAAATGGTACATAAACTAG
GAATGTGATTTTAAAATAAACGAAATAAGCATAGTCAGGCCTCACATGAG
CAAAAGTAGGTATCAACGTAGTTTCATATTTGATTTGTTTATTTTGAATA
ACGCTGATTGGCCATCAGGTGTATGCAGATCTAATATTCCAACAAAGAAA
TGTAGCTTTTTGATAAAAACCCAAATATGTTTTGTGGCACTCATCTTTCC
GCAGTCTTAGCTTTGTATCGAGCGATTCAAACGAAAATAAAAACATGAAG
CCTCTCGACTGCAGGTAACTCAGTAGCCGCGAGAGGCGCAAAAAAACATC
AAAAAAAAAAAAAAAAAAA

GH13992.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-RA 1382 shrb-RA 36..1287 1..1252 6260 100 Plus
shrb.a 1222 shrb.a 36..1042 1..1007 5035 100 Plus
shrb.a 1222 shrb.a 1041..1222 1069..1250 910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5029713..5030223 1250..740 2540 99.8 Minus
chr2R 21145070 chr2R 5030280..5030567 744..457 1410 99.3 Minus
chr2R 21145070 chr2R 5031187..5031464 278..1 1375 99.6 Minus
chr2R 21145070 chr2R 5030625..5030805 457..277 905 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-RA 681 CG8055-PA 1..681 101..781 3405 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:50:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-RA 1267 CG8055-RA 18..1267 1..1250 6250 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-PA 226 CG8055-PA 1..226 101..778 627 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9142144..9142656 1252..740 2565 100 Minus
2R 25286936 2R 9142713..9143000 744..457 1425 99.7 Minus
2R 25286936 2R 9143620..9143897 278..1 1390 100 Minus
2R 25286936 2R 9143058..9143238 457..277 905 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9143343..9143855 1252..740 2565 100 Minus
2R 25260384 2R 9143912..9144199 744..457 1425 99.6 Minus
2R 25260384 2R 9144819..9145096 278..1 1390 100 Minus
2R 25260384 2R 9144257..9144437 457..277 905 100 Minus
Blast to na_te.dros performed 2014-11-27 09:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
baggins 5453 baggins BAGGINS 5453bp 1580..1648 548..613 122 66.7 Plus

GH13992.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:19:09 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5031187..5031464 1..278 99   Minus
chr2R 5030626..5030803 279..456 100 <- Minus
chr2R 5030284..5030567 457..740 99 <- Minus
chr2R 5029713..5030222 741..1250 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:41:23 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 1..681 101..781 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:27 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 1..681 101..781 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:51:25 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 1..681 101..781 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:15 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 1..681 101..781 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:19:09 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 1..681 101..781 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:15:02 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 14..1263 1..1250 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:27 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 14..1263 1..1250 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:51:25 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 18..1267 1..1250 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:15 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 14..1263 1..1250 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:19:09 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 18..1267 1..1250 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:19:09 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9143620..9143897 1..278 100   Minus
2R 9143059..9143236 279..456 100 <- Minus
2R 9142717..9143000 457..740 100 <- Minus
2R 9142146..9142655 741..1250 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:51:25 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5031125..5031402 1..278 100   Minus
arm_2R 5030564..5030741 279..456 100 <- Minus
arm_2R 5030222..5030505 457..740 100 <- Minus
arm_2R 5029651..5030160 741..1250 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:42 Download gff for GH13992.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9144819..9145096 1..278 100   Minus
2R 9144258..9144435 279..456 100 <- Minus
2R 9143916..9144199 457..740 100 <- Minus
2R 9143345..9143854 741..1250 100 <- Minus

GH13992.pep Sequence

Translation from 100 to 780

> GH13992.pep
MSFFGKMFGGKKEVAPTTGEAIQKLRETENMLIKKQEFLEAKIEDELNIA
RKNASKNKRVALQALKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTA
VLTTMKNAADALKRAHQNMDVDKVHDMMDDIAEQQDVAREISDAISNPVA
FGADLDDEDLERELDELEQENFDKEIIGIPEPTPTLPEAPTEDLPEKAKE
KKKATTTTAVEDDDDPDMKQLLSWSN*

GH13992.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12950-PA 226 GF12950-PA 1..225 1..225 1077 97.3 Plus
Dana\GF11904-PA 219 GF11904-PA 1..188 4..195 160 32.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10579-PA 226 GG10579-PA 1..226 1..226 1072 97.8 Plus
Dere\GG15798-PA 226 GG15798-PA 4..194 3..191 147 27.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19872-PA 228 GH19872-PA 1..228 1..226 982 93 Plus
Dgri\GH15350-PA 226 GH15350-PA 4..173 3..170 147 28.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-PA 226 CG8055-PA 1..226 1..226 1135 100 Plus
Vps20-PC 212 CG4071-PC 2..211 5..211 202 31.8 Plus
Vps20-PA 212 CG4071-PA 2..211 5..211 202 31.8 Plus
Vps60-PB 226 CG6259-PB 5..196 4..193 191 26.7 Plus
Vps60-PA 226 CG6259-PA 5..196 4..193 191 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19821-PA 227 GI19821-PA 1..226 1..225 1029 93.4 Plus
Dmoj\GI19533-PA 220 GI19533-PA 1..188 4..198 151 29.3 Plus
Dmoj\GI12953-PA 226 GI12953-PA 4..193 3..190 144 26.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17464-PA 231 GL17464-PA 1..231 1..226 1033 90.5 Plus
Dper\GL11590-PA 212 GL11590-PA 3..185 2..195 149 30 Plus
Dper\GL25031-PA 208 GL25031-PA 4..173 3..170 145 27.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20793-PA 231 GA20793-PA 1..231 1..226 1033 90.5 Plus
Dpse\GA17936-PA 212 GA17936-PA 3..185 2..195 149 30 Plus
Dpse\GA19474-PA 228 GA19474-PA 4..194 3..191 148 26.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20627-PA 226 GM20627-PA 1..226 1..226 1138 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10100-PA 226 GD10100-PA 1..226 1..226 1138 98.2 Plus
Dsim\GD12393-PA 226 GD12393-PA 4..194 3..191 147 27.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18577-PA 228 GJ18577-PA 1..228 1..226 1045 93.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22870-PA 227 GK22870-PA 1..227 1..226 1069 93 Plus
Dwil\GK10800-PA 227 GK10800-PA 4..173 3..170 141 27.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22521-PA 226 GE22521-PA 1..226 1..226 1138 98.2 Plus
Dyak\GE22134-PA 226 GE22134-PA 4..194 3..191 147 27.5 Plus

GH13992.hyp Sequence

Translation from 100 to 780

> GH13992.hyp
MSFFGKMFGGKKEVAPTTGEAIQKLRETENMLIKKQEFLEAKIEDELNIA
RKNASKNKRVALQALKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTA
VLTTMKNAADALKRAHQNMDVDKVHDMMDDIAEQQDVAREISDAISNPVA
FGADLDDEDLERELDELEQENFDKEIIGIPEPTPTLPEAPTEDLPEKAKE
KKKATTTTAVEDDDDPDMKQLLSWSN*

GH13992.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-PA 226 CG8055-PA 1..226 1..226 1135 100 Plus
Vps20-PC 212 CG4071-PC 2..211 5..211 202 31.8 Plus
Vps20-PA 212 CG4071-PA 2..211 5..211 202 31.8 Plus
Vps60-PB 226 CG6259-PB 5..196 4..193 191 26.7 Plus
Vps60-PA 226 CG6259-PA 5..196 4..193 191 26.7 Plus