Clone GH14055 Report

Search the DGRC for GH14055

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:140
Well:55
Vector:pOT2
Associated Gene/TranscriptCG8974-RA
Protein status:GH14055.pep: gold
Preliminary Size:2309
Sequenced Size:1703

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8974 2001-07-04 Blastp of sequenced clone
CG8974 2008-04-29 Release 5.5 accounting
CG8974 2008-08-15 Release 5.9 accounting
CG8974 2008-12-18 5.12 accounting

Clone Sequence Records

GH14055.complete Sequence

1703 bp (1703 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060297

> GH14055.complete
CCCAATTTTACCGTAACATAACACACTTGTCCACACAATCAATTTAGCAA
CATTCTCTGATTCGGTTTAACAATACTTAGCACGGTAGATGGAAACCTTC
TAGCCCTATATACACGCGAGTGTTTGAGTGTGTAGATGTGTACATAAGTA
CGCACATAAGTCCAGGTACATATGCAGCCAATGGGAATGTTCGGTCATTA
TCCTTGAAGACTTGGTGGTAAATACGCCCTTTGGGCGGTTTTCGTAGCCA
TAAACACCACCCCATGGGGTCGGACAAATGCTGAATGCTGCGGAACTCGG
GGGAAACCCCCTTCAAACTGCGCTTGAAGTATTTAATTAAATTAAGTCAT
ATTCAAGAAAGTGCGGACCTTAGTTGTACACCAGAAATGGCCTAGGAAAA
TCATCTAAGCAATCTAGGCACTTGTCAATAGGCTTGAACGACTAAAACTT
TACCCGCATCTTGGGCAAACCATGGAGGAACCGAAAAGTGTACCCACAGC
GGAGCTTCCCAGCACATCAACCGGGGCATCGTCGTCCTCATCGACTTTGT
CCAACAACGTGAGCTACGACAAGATAGCCTGGACTCGGGATATCACAGAA
CCCTTGGCTGAGGAGTCATCTACAAGTCAATTGCGCCCGCTGGGTACCTC
GATTCCAACCAATTCGACGGCATCGGAACTGAAGAAGTCCAACACTTCGT
ATTCCTTTACTGGAGACTATCTATCTGGTGGCAATAAGGCCGATCTGAAG
GGTGGCTATCCATTCGGCGGCACCGATACGGACACAAAAGCCAACGAAAA
GGACAAGGAGAAGGAACATACCGCAGACGACTCACTCTACGAGTGCAACA
TATGCCTGGACACCGCCAAGGATGCTGTGGTCAGCATGTGCGGCCATCTG
TTCTGCTGGCCGTGCCTGCATCAGTGGCTCCTGACGCGTCCCAATCGCAA
ACTCTGTCCCGTTTGTAAGGCTGCCGTTGATAAGGATAAGGTCATACCGC
TGTACGGAAGAAATAGTACACACCAGGAAGATCCACGTAACAAAGTTCCA
CCACGCCCCGCTGGACAACGTACAGAACCAGATCCTGTTCCCGGGTTCCC
TGGATTCGGATTCGGCGACGGATTTCACATGTCTTTCGGTATTGGAGCTT
TTCCTTTCGGGTTCATAACATCTACGCTCAACTTTGGCGAACCACGTCCA
CCTGCTGCTAATCGGGGAACAAGGCAATACGAGGATGAACAGACCCTGTC
CAAGCTGTTTTCGTATTTGGCCGTTGTGTGGATATTGTGGCTGTTCTATG
CATAGCAATCTGCGAACGCATAAAGACATCACCCCGATAAGAAGAACCTA
TGTTCAAATGTGTATGGAAAGCGTGCGAAGTAATCATATAGCAGTATCCT
CCAGTTAAATCAACAATATTCTTAAACTCGTTGGGCAATAGTCGTTGGTG
TGATTAATTAACATAAATTGTTAGCATTCGGTTATAATTGTAATTTGAGG
ATTCGCAAAACAGAAGTGGATTGGATCCCAAACTATTTCAAAAAGTCCGC
GATACCCTACGACTCCAGCATAAAAAACTGAAATTTCGAAATCATTGGAT
CGTAATGATTTAATTCAAATGTAGATGTCAAAAATTGTATAAATATATAT
TTTAAATTCGATAAAACATTAAAAACATTTATTTCAAAAAAAAAAAAAAA
AAA

GH14055.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-RC 1761 CG8974-RC 74..1761 1..1687 8370 99.8 Plus
CG8974-RB 1416 CG8974-RB 162..1416 433..1687 6275 100 Plus
CG8974-RA 1504 CG8974-RA 241..1495 433..1687 6275 100 Plus
CG8974-RB 1416 CG8974-RB 74..158 1..85 425 100 Plus
CG8974-RA 1504 CG8974-RA 74..158 1..85 425 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15684356..15684961 1037..432 3030 100 Minus
chrX 22417052 chrX 15687526..15688131 1037..432 3015 99.8 Minus
chrX 22417052 chrX 15683580..15684061 1685..1204 2410 100 Minus
chrX 22417052 chrX 15686768..15687124 1684..1328 1545 95.5 Minus
chrX 22417052 chrX 15685020..15685280 432..173 1255 99.6 Minus
chrX 22417052 chrX 15688190..15688450 432..173 1255 99.6 Minus
chrX 22417052 chrX 15684126..15684293 1204..1037 840 100 Minus
chrX 22417052 chrX 15687296..15687463 1204..1037 795 98.2 Minus
chrX 22417052 chrX 15685346..15685439 177..84 470 100 Minus
chrX 22417052 chrX 15688516..15688609 177..84 470 100 Minus
chrX 22417052 chrX 15685751..15685835 85..1 425 100 Minus
chr3L 24539361 chr3L 15111737..15111915 836..1014 310 78.2 Plus
chrX 22417052 chrX 15688912..15688972 85..25 305 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-RE 834 CG8974-PE 1..834 472..1305 4170 100 Plus
CG8974-RD 834 CG8974-PD 1..834 472..1305 4170 100 Plus
CG8974-RB 834 CG8974-PB 1..834 472..1305 4170 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:50:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-RC 1734 CG8974-RC 53..1734 1..1685 8285 99.7 Plus
CG8974-RD 1280 CG8974-RD 27..1280 432..1685 6270 100 Plus
CG8974-RB 1389 CG8974-RB 136..1389 432..1685 6270 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-PE 277 CG8974-PE 1..277 472..1302 1312 100 Plus
CG8974-PD 277 CG8974-PD 1..277 472..1302 1312 100 Plus
CG8974-PB 277 CG8974-PB 1..277 472..1302 1312 100 Plus
CG8974-PA 277 CG8974-PA 1..277 472..1302 1312 100 Plus
CG8974-PC 277 CG8974-PC 1..277 472..1302 1312 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15794497..15795102 1037..432 3030 100 Minus
X 23542271 X 15797667..15798272 1037..432 3015 99.8 Minus
X 23542271 X 15793719..15794202 1687..1204 2420 100 Minus
X 23542271 X 15796909..15797265 1684..1328 1545 95.5 Minus
X 23542271 X 15795161..15795421 432..173 1255 99.6 Minus
X 23542271 X 15798331..15798591 432..173 1255 99.6 Minus
X 23542271 X 15794267..15794434 1204..1037 840 100 Minus
X 23542271 X 15797437..15797604 1204..1037 795 98.2 Minus
X 23542271 X 15795487..15795580 177..84 470 100 Minus
X 23542271 X 15798657..15798750 177..84 470 100 Minus
X 23542271 X 15795892..15795976 85..1 425 100 Minus
3L 28110227 3L 15121665..15121843 836..1014 310 78.2 Plus
X 23542271 X 15799053..15799113 85..25 305 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15802595..15803200 1037..432 3030 100 Minus
X 23527363 X 15805765..15806370 1037..432 3015 99.8 Minus
X 23527363 X 15801817..15802300 1687..1204 2420 100 Minus
X 23527363 X 15805007..15805363 1684..1328 1545 95.5 Minus
X 23527363 X 15806429..15806689 432..173 1265 99.6 Minus
X 23527363 X 15803259..15803519 432..173 1265 99.6 Minus
X 23527363 X 15802365..15802532 1204..1037 840 100 Minus
X 23527363 X 15805535..15805702 1204..1037 795 98.2 Minus
X 23527363 X 15806755..15806848 177..84 470 100 Minus
X 23527363 X 15803585..15803678 177..84 470 100 Minus
X 23527363 X 15803990..15804074 85..1 425 100 Minus
3L 28103327 3L 15114765..15114943 836..1014 310 78.2 Plus
X 23527363 X 15807151..15807211 85..25 305 100 Minus
Blast to na_te.dros performed 2014-11-27 03:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1994..2133 1530..1684 125 61.3 Plus

GH14055.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:22:58 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15685748..15685835 1..88 97   Minus
chrX 15685346..15685434 89..177 100 <- Minus
chrX 15685020..15685275 178..432 99 <- Minus
chrX 15684356..15684960 433..1037 100 <- Minus
chrX 15684126..15684292 1038..1204 100 <- Minus
chrX 15683580..15684060 1205..1685 93 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:41:28 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 1..834 472..1305 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:26:56 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 1..834 472..1305 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:41 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 1..834 472..1305 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:00:08 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 1..834 472..1305 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:22:58 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 1..834 472..1305 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:26:13 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RC 74..1759 1..1685 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:26:56 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RC 74..1759 1..1685 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:41 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RC 53..1734 1..1685 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:00:08 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RC 74..1759 1..1685 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:22:58 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RC 53..1734 1..1685 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:22:58 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
X 15795889..15795976 1..88 97   Minus
X 15795487..15795575 89..177 100 <- Minus
X 15795161..15795416 178..432 99 <- Minus
X 15794497..15795101 433..1037 100 <- Minus
X 15794267..15794433 1038..1204 100 <- Minus
X 15793721..15794201 1205..1685 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:41 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15689922..15690009 1..88 97   Minus
arm_X 15689520..15689608 89..177 100 <- Minus
arm_X 15689194..15689449 178..432 99 <- Minus
arm_X 15688530..15689134 433..1037 100 <- Minus
arm_X 15688300..15688466 1038..1204 100 <- Minus
arm_X 15687754..15688234 1205..1685 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:37:59 Download gff for GH14055.complete
Subject Subject Range Query Range Percent Splice Strand
X 15803987..15804074 1..88 97   Minus
X 15803585..15803673 89..177 100 <- Minus
X 15803259..15803514 178..432 99 <- Minus
X 15802595..15803199 433..1037 100 <- Minus
X 15802365..15802531 1038..1204 100 <- Minus
X 15801819..15802299 1205..1685 100 <- Minus

GH14055.pep Sequence

Translation from 471 to 1304

> GH14055.pep
MEEPKSVPTAELPSTSTGASSSSSTLSNNVSYDKIAWTRDITEPLAEESS
TSQLRPLGTSIPTNSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGG
TDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLH
QWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRNKVPPRPAGQR
TEPDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSTLNFGEPRPPAANRGT
RQYEDEQTLSKLFSYLAVVWILWLFYA*

GH14055.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19745-PA 252 GF19745-PA 1..252 1..277 552 48.8 Plus
Dana\GF19854-PA 189 GF19854-PA 1..186 1..192 432 47.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19371-PA 277 GG19371-PA 1..277 1..277 1183 89.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12208-PA 273 GH12208-PA 12..273 5..277 878 63.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-PE 277 CG8974-PE 1..277 1..277 1501 100 Plus
CG8974-PD 277 CG8974-PD 1..277 1..277 1501 100 Plus
CG8974-PB 277 CG8974-PB 1..277 1..277 1501 100 Plus
CG8974-PA 277 CG8974-PA 1..277 1..277 1501 100 Plus
CG8974-PC 277 CG8974-PC 1..277 1..277 1501 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15740-PA 285 GI15740-PA 4..285 3..277 848 56.7 Plus
Dmoj\GI13710-PA 151 GI13710-PA 2..151 109..276 335 43.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22919-PA 280 GL22919-PA 1..280 1..277 771 62.7 Plus
Dper\GL14111-PA 280 GL14111-PA 1..280 1..277 771 62.7 Plus
Dper\GL14112-PA 251 GL14112-PA 11..251 48..277 756 72.4 Plus
Dper\GL22918-PA 241 GL22918-PA 1..241 1..277 750 63 Plus
Dper\GL13244-PA 229 GL13244-PA 63..229 79..277 456 48.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28677-PA 242 GA28677-PA 1..231 1..228 606 62.1 Plus
Dpse\GA22629-PA 217 GA22629-PA 31..217 82..277 457 44.4 Plus
Dpse\GA28600-PA 229 GA28600-PA 63..229 79..277 454 48.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22525-PA 277 GM22525-PA 1..277 1..277 1204 91.3 Plus
Dsec\GM25509-PA 165 GM25509-PA 11..154 117..266 394 50.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15775-PA 277 GD15775-PA 1..277 1..277 1217 92.1 Plus
Dsim\GD15776-PA 58 GD15776-PA 1..58 220..277 259 79.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18601-PA 272 GJ18601-PA 57..272 62..277 831 73.3 Plus
Dvir\GJ14052-PA 150 GJ14052-PA 2..132 109..240 355 51.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25237-PA 292 GK25237-PA 5..292 11..277 702 58.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16019-PA 277 GE16019-PA 1..276 1..276 1105 87 Plus

GH14055.hyp Sequence

Translation from 471 to 1304

> GH14055.hyp
MEEPKSVPTAELPSTSTGASSSSSTLSNNVSYDKIAWTRDITEPLAEESS
TSQLRPLGTSIPTNSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGG
TDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLH
QWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRNKVPPRPAGQR
TEPDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSTLNFGEPRPPAANRGT
RQYEDEQTLSKLFSYLAVVWILWLFYA*

GH14055.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-PE 277 CG8974-PE 1..277 1..277 1501 100 Plus
CG8974-PD 277 CG8974-PD 1..277 1..277 1501 100 Plus
CG8974-PB 277 CG8974-PB 1..277 1..277 1501 100 Plus
CG8974-PA 277 CG8974-PA 1..277 1..277 1501 100 Plus
CG8974-PC 277 CG8974-PC 1..277 1..277 1501 100 Plus