Clone GH14673 Report

Search the DGRC for GH14673

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:146
Well:73
Vector:pOT2
Associated Gene/TranscriptCHKov2-RA
Protein status:GH14673.pep: gold
Preliminary Size:1372
Sequenced Size:1453

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10675 2001-01-01 Release 2 assignment
CG10675 2001-09-19 Blastp of sequenced clone
CG10675 2003-01-01 Sim4 clustering to Release 3
CHKov2 2008-04-29 Release 5.5 accounting
CHKov2 2008-08-15 Release 5.9 accounting
CHKov2 2008-12-18 5.12 accounting

Clone Sequence Records

GH14673.complete Sequence

1453 bp (1453 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058384

> GH14673.complete
TAATATCGGACGTTAGCGCATCTAAACAAAGTTAAAATGACTGACCAACC
AACTCCACAGTGGGTGACCAAGGAGCTATTCAGCAGCTTGTTGGAACAGA
GTAATCGAAATTTCAAGGCGATCATTAAATTTGTTCCAACATCAGCGATT
AGCAAAGGGGAAAACTATTTGACGATCGTGCTGCGCATACAAATTGAAAT
GCAGCTGAAAGATAACAGCATAGAAGATGTCAGCTACATACTGAAGATTC
CTTTAGTCCCGGAAGATGAGAAGAACGACTTCCACGAAATGTTCGATGCC
GAACTGGACATGTACGATCATCTGATACCAGAATTGGAGGATCTATATGC
CAAAAACACTTCCATATCACCAAAATTCAAGCCTGTTCATCTGAAGTTTC
CAGGAGAGCCGGTAAAAAGCGACTACATTCTTTTGGAGGATCTGCGGAAG
AAGGGATATAGGAATGCCGACAGAACCCAGGGATTGGAGCAGTTTGAAGT
GGAGGCGGTCCTCAAGAAGTTGGCACAGTGGCACGCAGCCTCTGCAAAAA
GAGTAGTCGAGCTGGGTGAATACGAGAAGGACATCCGGGAGAGTTACTTT
ACTACTGAGCACCAGAAATTACTCGATGAATTCAACATTAATTTTTGTAT
GCCCTTCCTGGAGTGCATGCAGCAATATAATCTTGAGCCAGGACAGCTCG
TTCTCATAAGCGACTATACATCTCAACTGACGGATCTGAATATTGAGTTT
GGTAAGAACGATCCTCTGGAGTTATCTGTGTTAAACCACGGAGATTTTTG
GTGCAATAACTTTATGTTCAAGTATAAAAACGCCTCAGAAGTGGAGGACG
TTTGCTTTGTTGACTTCCAGCTCCCAAAATATGGCACACCCGCCCAAGAT
CTTCTATGCATACTGATGACCTCACCTAAGTTTTCAATCAAACTGGACAA
ATTCGACTATTTCATAGAGTATTATCACCAGCAGCTAGTCGAACACCTCA
CTATGCTCAATTACAATCGGAATGCACCCACACTATCCAAGTTCCACGCC
CATCTACACCGATATAGTCTCTGGGCTTTCATATGCGCCCAGCGAATGCT
TCCAATTGTTCTGCTCCCGCCCGATGTTGATTCACATATAGGCAACGTAA
TGGGTAATTCGGAGGAGGCGATCGCGTTTAAGCGTAAGATGTTCCTGTTG
CCGGCTTACGTGGATCAGATAAAAGTCATATTGCCATGGCTCATTAACCG
GGGTTACATAAGATAGACGGAGGATGCAATGATAAACAAGTTTCTAGAGA
ACGAATAGTGTAATAATAATATTGTATTGCATTCATACAAACATGTTGTT
CACAAACTATCTCAAAATGCTAGGTGTTAGTATAAGCTAATACGAGAGGG
TTTTTTTAAATAAATGTGCATAGTTTTACAAAAAAAAAAAAAAAAAAAAA
AAA

GH14673.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-RA 1688 CHKov2-RA 154..1588 1..1435 7175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21153526..21154024 708..210 2435 99.2 Minus
chr3R 27901430 chr3R 21152633..21152986 1429..1075 1665 98.6 Minus
chr3R 27901430 chr3R 21154071..21154285 215..1 1045 99.1 Minus
chr3R 27901430 chr3R 21153052..21153244 1075..883 935 99 Minus
chr3R 27901430 chr3R 21153299..21153474 884..709 865 99.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-RA 1230 CG10675-PA 1..1230 37..1266 6150 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-RA 1450 CG10675-RA 22..1450 1..1429 7145 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-PA 409 CG10675-PA 1..409 37..1263 2163 100 Plus
CG10562-PA 405 CG10562-PA 1..401 37..1254 726 38.6 Plus
CHKov1-PE 410 CG10618-PE 7..405 55..1254 715 36.2 Plus
CG10560-PA 414 CG10560-PA 16..411 49..1254 700 36.6 Plus
CG10553-PA 414 CG10553-PA 18..411 55..1254 669 35.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25330423..25330921 708..210 2495 100 Minus
3R 32079331 3R 25329524..25329884 1435..1075 1805 100 Minus
3R 32079331 3R 25330968..25331182 215..1 1060 99.5 Minus
3R 32079331 3R 25329950..25330142 1075..883 965 100 Minus
3R 32079331 3R 25330197..25330372 884..709 880 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25071254..25071752 708..210 2495 100 Minus
3R 31820162 3R 25070355..25070715 1435..1075 1805 100 Minus
3R 31820162 3R 25071799..25072013 215..1 1060 99.5 Minus
3R 31820162 3R 25070781..25070973 1075..883 965 100 Minus
3R 31820162 3R 25071028..25071203 884..709 880 100 Minus
Blast to na_te.dros performed 2014-11-27 08:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1049..1142 1350..1258 116 59.6 Minus

GH14673.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:09:42 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21154075..21154285 1..211 99   Minus
chr3R 21153526..21154022 212..708 99 <- Minus
chr3R 21153300..21153474 709..883 99 <- Minus
chr3R 21153052..21153243 884..1075 98 <- Minus
chr3R 21152633..21152985 1076..1429 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:43:14 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 1..1230 37..1266 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:07:10 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 1..1230 37..1266 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:02:13 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 1..1230 37..1266 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:37:59 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 1..1230 37..1266 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:42 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 1..1230 37..1266 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:57:13 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 21..1449 1..1429 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:07:10 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 21..1449 1..1429 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:02:13 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 22..1450 1..1429 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:37:59 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 21..1449 1..1429 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:42 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 22..1450 1..1429 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:09:42 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25330972..25331182 1..211 100   Minus
3R 25330423..25330919 212..708 100 <- Minus
3R 25330198..25330372 709..883 100 <- Minus
3R 25329950..25330141 884..1075 100 <- Minus
3R 25329530..25329883 1076..1429 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:02:13 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21156694..21156904 1..211 100   Minus
arm_3R 21156145..21156641 212..708 100 <- Minus
arm_3R 21155920..21156094 709..883 100 <- Minus
arm_3R 21155672..21155863 884..1075 100 <- Minus
arm_3R 21155252..21155605 1076..1429 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:15:11 Download gff for GH14673.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25071803..25072013 1..211 100   Minus
3R 25071254..25071750 212..708 100 <- Minus
3R 25071029..25071203 709..883 100 <- Minus
3R 25070781..25070972 884..1075 100 <- Minus
3R 25070361..25070714 1076..1429 100 <- Minus

GH14673.pep Sequence

Translation from 36 to 1265

> GH14673.pep
MTDQPTPQWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLR
IQIEMQLKDNSIEDVSYILKIPLVPEDEKNDFHEMFDAELDMYDHLIPEL
EDLYAKNTSISPKFKPVHLKFPGEPVKSDYILLEDLRKKGYRNADRTQGL
EQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFTTEHQKLLDEFN
INFCMPFLECMQQYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLELSVLN
HGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFS
IKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFIC
AQRMLPIVLLPPDVDSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILP
WLINRGYIR*

GH14673.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17412-PA 821 GF17412-PA 1..409 1..408 1679 75.6 Plus
Dana\GF17412-PA 821 GF17412-PA 412..816 1..406 773 39.6 Plus
Dana\GF17413-PA 408 GF17413-PA 1..405 1..406 759 39.1 Plus
Dana\GF17415-PA 413 GF17415-PA 14..410 3..406 721 39.3 Plus
Dana\GF17414-PA 414 GF17414-PA 18..413 7..408 719 39.1 Plus
Dana\GF17417-PA 412 GF17417-PA 9..406 3..406 706 36.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12253-PA 409 GG12253-PA 1..409 1..409 2066 91.9 Plus
Dere\GG12255-PA 409 GG12255-PA 1..405 1..406 756 38.1 Plus
Dere\GG12254-PA 410 GG12254-PA 1..405 1..406 746 37.7 Plus
Dere\GG12257-PA 414 GG12257-PA 18..411 7..406 702 37.1 Plus
Dere\GG12256-PA 414 GG12256-PA 16..411 5..406 661 36.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19355-PA 409 GH19355-PA 1..408 1..408 1289 58.4 Plus
Dgri\GH19360-PA 409 GH19360-PA 1..408 1..408 1288 58.4 Plus
Dgri\GH19358-PA 420 GH19358-PA 10..413 2..406 766 37.1 Plus
Dgri\GH19361-PA 427 GH19361-PA 17..420 7..409 683 35.9 Plus
Dgri\GH19357-PA 426 GH19357-PA 16..419 7..409 658 34.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-PA 409 CG10675-PA 1..409 1..409 2163 100 Plus
CG10562-PA 405 CG10562-PA 1..401 1..406 726 38.6 Plus
CHKov1-PE 410 CG10618-PE 7..405 7..406 715 36.2 Plus
CG10560-PA 414 CG10560-PA 16..411 5..406 700 36.6 Plus
CG10553-PA 414 CG10553-PA 18..411 7..406 669 35.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22564-PA 408 GI22564-PA 5..407 6..408 1309 60.7 Plus
Dmoj\GI22567-PA 417 GI22567-PA 10..413 2..406 698 36.9 Plus
Dmoj\GI23543-PA 879 GI23543-PA 37..450 1..406 678 36.5 Plus
Dmoj\GI22566-PA 705 GI22566-PA 14..353 6..346 659 38.8 Plus
Dmoj\GI23541-PA 444 GI23541-PA 31..440 5..406 646 37.6 Plus
Dmoj\GI23543-PA 879 GI23543-PA 485..875 9..406 551 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22088-PA 286 GL22088-PA 3..286 126..409 1215 77.1 Plus
Dper\GL22090-PA 415 GL22090-PA 1..405 1..406 744 38.2 Plus
Dper\GL22089-PA 415 GL22089-PA 1..405 1..406 744 38.2 Plus
Dper\GL22092-PA 416 GL22092-PA 18..413 7..406 715 37.4 Plus
Dper\GL22091-PA 405 GL22091-PA 10..402 7..406 696 37.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27374-PA 409 GA27374-PA 1..409 1..409 1626 72.6 Plus
Dpse\GA22521-PA 406 GA22521-PA 1..378 1..378 1501 72.5 Plus
Dpse\GA22522-PA 415 GA22522-PA 1..405 1..406 746 38.2 Plus
Dpse\GA27375-PA 415 GA27375-PA 1..405 1..406 744 38.2 Plus
Dpse\GA10394-PA 416 GA10394-PA 18..413 7..406 718 37.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17719-PA 409 GM17719-PA 1..409 1..409 2124 96.3 Plus
Dsec\GM17720-PA 410 GM17720-PA 1..405 1..406 747 37.4 Plus
Dsec\GM17721-PA 405 GM17721-PA 1..401 1..406 740 38.4 Plus
Dsec\GM17724-PA 414 GM17724-PA 18..411 7..406 700 37 Plus
Dsec\GM17723-PA 414 GM17723-PA 16..411 5..406 684 36.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CHKov2-PA 409 GD18203-PA 1..409 1..409 2122 96.3 Plus
Dsim\GD18204-PA 410 GD18204-PA 1..405 1..406 754 37.2 Plus
Dsim\GD18205-PA 405 GD18205-PA 1..401 1..406 725 38.1 Plus
Dsim\GD18206-PA 414 GD18206-PA 16..411 5..406 679 36.1 Plus
Dsim\GD18207-PA 397 GD18207-PA 18..394 7..406 665 36 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23753-PA 409 GJ23753-PA 1..408 1..408 1283 58.2 Plus
Dvir\GJ23755-PA 418 GJ23755-PA 15..415 7..408 768 38.4 Plus
Dvir\GJ23756-PA 419 GJ23756-PA 15..417 6..408 716 35.9 Plus
Dvir\GJ10289-PA 475 GJ10289-PA 62..471 5..406 670 35.7 Plus
Dvir\GJ23754-PA 424 GJ23754-PA 17..420 7..409 660 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14326-PA 417 GK14326-PA 10..417 7..409 1410 64 Plus
Dwil\GK14323-PA 411 GK14323-PA 11..411 9..409 1035 52.3 Plus
Dwil\GK14324-PA 528 GK14324-PA 137..528 7..409 1013 50.2 Plus
Dwil\GK14328-PA 416 GK14328-PA 13..411 7..406 790 40 Plus
Dwil\GK11591-PA 416 GK11591-PA 8..411 3..406 748 38.6 Plus
Dwil\GK14324-PA 528 GK14324-PA 3..132 127..262 302 46.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10703-PA 409 GE10703-PA 1..409 1..409 2094 93.6 Plus
Dyak\CHKov1-PA 410 GE10704-PA 1..405 1..406 763 38.1 Plus
Dyak\GE10705-PA 409 GE10705-PA 1..405 1..406 748 38.1 Plus
Dyak\GE10706-PA 414 GE10706-PA 16..411 5..406 709 37.1 Plus
Dyak\GE10707-PA 414 GE10707-PA 18..411 7..406 696 37.3 Plus

GH14673.hyp Sequence

Translation from 36 to 1265

> GH14673.hyp
MTDQPTPQWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLR
IQIEMQLKDNSIEDVSYILKIPLVPEDEKNDFHEMFDAELDMYDHLIPEL
EDLYAKNTSISPKFKPVHLKFPGEPVKSDYILLEDLRKKGYRNADRTQGL
EQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFTTEHQKLLDEFN
INFCMPFLECMQQYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLELSVLN
HGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFS
IKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFIC
AQRMLPIVLLPPDVDSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILP
WLINRGYIR*

GH14673.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-PA 409 CG10675-PA 1..409 1..409 2163 100 Plus
CG10562-PA 405 CG10562-PA 1..401 1..406 726 38.6 Plus
CHKov1-PE 410 CG10618-PE 7..405 7..406 715 36.2 Plus
CG10560-PA 414 CG10560-PA 16..411 5..406 700 36.6 Plus
CG10553-PA 414 CG10553-PA 18..411 7..406 669 35.7 Plus