Clone GH15225 Report

Search the DGRC for GH15225

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:152
Well:25
Vector:pOT2
Associated Gene/TranscriptUlp1-RA
Protein status:GH15225.pep: gold
Sequenced Size:5432

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Ulp1 2008-04-29 Release 5.5 accounting
Ulp1 2008-04-29 Picked prior to 5.5
Ulp1 2008-08-15 Release 5.9 accounting
Ulp1 2008-12-18 5.12 accounting

Clone Sequence Records

GH15225.complete Sequence

5432 bp assembled on 2007-09-19

GenBank Submission: BT030817

> GH15225.complete
AAGTTGCGAAAATTTTCTCAAGTCACAGTGAAAAGTGTACATTGTTTAAA
ACCTGGCCAAGGGCTAAAAGTAGCGAAAGCGGTAGCGAACACACGCATGT
CGCTGCCTCCCGAGGACACCGATTTGTCCACAAATTCCGCATACGAATCC
GCACTCCAAATCGCGAGCAATGTGTCGGCAGCACGAGTAGTCGGTTCGGC
AGTAGGACAGCGATTTTCGCCGTCGCCAGCAGCTCACCCGAACGTGATTG
AGCGCGTCGCGTCTCATGTGGACTCACGCCGCAGCACGTTTCCAAGTTGG
GGTAATCCGTCAGTAGCGCCAAGAGGATCGGAAGAAGCAGCAGCCAACGC
CACAGCAACACAACTCCTATGGGCGGAGAACCAAGGTCTCCCGACATCGC
ACTTATTGCCAACTGAACAGGCATTCGAGACATTGAACACTAATGCGTAT
TGTTCCCCGCCAGGGGATTCACGATTTACGTTCCCTAGCCAGAACTACTC
GCCGCTGCTGCCGCGGTGTGTCCCAGTTCCGAATCAGCGTTACTCTCCAG
ATGGATCGCCAATACATCAACTCCATGAGCTGCAAAATTGTCCATTGATA
GATTCGCCGATAAGACTGCGATTTCCATCCCCCTTGCCAGAACCACCATC
ACTACCGACCATCACCCTTACAGTTGATGCCCTGATCGATCTTGACCAAA
ACAACCAGGTCGCATATTATGTCCAGCAGTACAACAATCAGCCAGTCCTA
TATCAACAAAACATTCATATAGGAACGGGAATCCAACTATGCGATCAGGC
CTCCGAGAATAATCAACCGATTATATTACATATCGTGGAGCACAATCCCC
AGACTATAACTGAGAGCCAGGAGCAATTCCACCAGGTTGTCCCCGAAATT
CAAATCAATAATATCCAGGAGCAAGATCAGAAATTTGAAAATGGCATCTC
GGAACAAAATCATCCGATTGCAACTGAGGCTCAGGATCAGACTTTAACTG
AGATCCGGGATGAAAACCAGATTGTCCTTGCAGTCCAAGAAAAAAATCTC
ACGCGTGCCTCTGAGATTCAGGACCAGAACCAACAGACATTAACCGAGAT
CCCAGAGAAATGTCTTCAGATTGCATCTCCTGTCACTACTGATATACAGG
TACAAAGTCCTCAGGTTGTAATAGAGATCCAGGAGCAAAATCACCAGTCT
GTAACGGAGATCCAGGAGGAAGTTCACCAGACTGCCCCCGAAATCCAAGT
GAACGTTTTCCAGACCTCGTCTGATATTCAAGGGCAAAATCACCAGATTG
TAACTGAAGAGCAAAATCATCAGACTATAACCGAGACCCAGGAGGATTAC
TCGGCTGTCTCCGAAATCCAATGGGAAAATCTCTCGTTTTCTGCTGAGAT
TCAGGAGCAAAACCAGCAGATCGTAACCGAAGTTACGAAGCTTGCATCTC
CTTCTGTTACTGATATACAGGCACAAAGTCCTCAGTCCGTAATCGAGATC
CAGGATGACGATGATGAAGATCTAAAGTTCGAATCTGATGATCTGCACAC
TATACCTGAAATCCAGGAGAAAAACCAACAAAGTCCTCAGTTCGTAATCG
AGATCCATTATGATAATGAAGATCTAAAGTTCGCATCTGATAATCAGGAG
CAAGATCAACAAACAGCCGAGCTCCAAAAGGAAAGGTTCCAGTTCGCATC
TGAAATCGAGAAGCGAGATCTGCAGATTGTTACTGACACTCACAAACAAA
ATTATCACAATGTAACCGACATCCCGTTCGCAACATACATCCAGGAGGAA
AACGAGCAGTTAACACCGGAAGACCAAGAGGAAGATCAACATTACCTGAA
TTTTGAGGGGAACCAACAATTCCAGCTCCAGAAGCAAGATCAGCTGAGTG
TACCACAGATCCAGAAGCAAACCCACCAGTTCGAATCTAAGGTCAAAAAG
AGAAAGTTGCAGCCCTTTTCTGAATACCAGCAGAAAGGTCAGAAAGATCA
TATCCAAGAGAGGCAGTATATTCAGCAGGAATTCACCATCCACTCTAACC
AGGCTTATTCTAAGGTCCAGTATATACAAACTATACAAACTGCGACTCCG
TACGTACCTCAATTGGAAATATCCCAGGAAAACAGTTTTGAGGTTCAACC
AGCATACGAGGTAAACGAAGGCCAACGGGACAGAGAACTGGTTAGTTACA
CAGGCCACGAGCATCAGAACTTTGTTGATGAGGTCTCGACACCATTACCG
CCCGCTGAAGCTCAACCAGGATCTACTTCAGAAGATATATCAGACCCCGT
TTCACCTGAACATTGGGAGCAGCTAGAGTCACTCGATCCGAGCACTATTT
GTATTCGCAAAACCTTCAATCTAATTCGCGATATCTCTGAAAGTCTGGTG
GCCGATCCAGAGCAACCCGAAGCCGAAGCCCACCGGAAGTCAATTTTCCT
TCTCCGCCAGAAGCTAGCCGATGTGTGCCATAAGGTTCTAACCGAAATTA
TACACGGCCGGGCCACCGATGAGATCATCTCCATTCTGAGAGAGATTCTC
GAGCAAACTAAGGAAATACCTCCACGCCCCACGCCGAAAAGAGACCTCCA
AGAAGACATTTCGATGGGCTTAGAAATATTAAAAAAGATCCGTGGTATGC
TATCCGGTTGGTATTCTTCCAGAGAAAGCGAAACGGACTCCACGGATACC
GGAACGGGATTCCAGGCTCAAAACGGAAAAGGTTTTGGTGCCGGCCGCCA
GCCGGAAAATAGTTTTTTATCCCAGAAAAGACGCAACCAAGAAGAGAACC
CTCGTCTGATCAAGTACCGGCGTGTGGACAACAGCTTTCCCCGCTTGATA
ACGAATGAGACGGCCGAGGACCTGATTCCCAACAATTCGATGGCCAAGCG
GGATCAGCCCCAGAGCTCAAAGCGGCTCTCAATATTTAATCCGCCGGTAT
ACACGCAGCACCGAGTGCGCAATGATGCCCCCCACGTACCTACGCCATTT
GACGATGAGGAGTCGTCACAGAGACTTGCTAACGCGGGCCCATCATCCAG
GCCCATGACTTACTCGGATGCGGTGCGTCTAGGCCATAATGGCATCTCCG
AGTCGCGCGTAAATGGGCACTCCAGCCATACGGTGCGCAGAGAACCGTCT
CGGCTGCACAGAAGCATTCTGTCCCACGAGATGAACTGCAAGGATCAAGA
GCAGTATAACGAACTTATCCGTACCCAAACAAATTACGTGGGCAGTCGCT
ACCTCAAGCCGGGTACCCCGCCAACGTTTCAGCGGGCTAAAGCCCAGTCG
GCAACCAGTAGCAGCTGCTCACTGCAAGACAACCAATCGAATATAACAGA
TTCGTTCCCGTCGCCACATGGCCGTGCGAACCCTGAGCTAACGGAGTACG
CCAAATTGATCAACCGCCAGGAGAATGAGGAGAACAGGTCTCCGGCACCA
CAGCAGCCAAAGCGAAACGCTAGCAATAGCTCTGCCAGCCATGCGTCCAC
TATTTCCAGCAGCGCATCTTCCTCCTGCAGCACTTGTTCAACTTGCTCAT
CTTCTGACACTGAGCCAATGTTGGTTAAAGATAGCCCGGAGGTCAAGGAA
GCCAACGAAGCCAACGAGGCCAACGAAGCCAACGAAGCCAACGAAACCAA
GGAAAATGACGCACCTCAACCTACAACTACCAGAATCAAGAAACCAGACT
TCTTGCACCGTCGCTTTGCCAACTGTATCTTTCTAAGGAATGACTTTGCG
GAAAATTTCAAAGCAAGAGCGAATCGCCGGCAACTTGAATCCATGCATCT
TCTTGGAATAGCTGAACAGCAGGCTAATGAAAGCAAAGATGAACGCCTTG
CCTATGAAAAAAAGCTGCGGGAAGTCATGTTCCGGTCTGGTGCTCCCCAC
CGGCCCTTTTTTGAAATCGGGCCCCTGGAACAGCCGGAAGAGAAGAAAGA
GACCAAGCTCATTCCGCTAACAAAGGAGGACCACGCTCGCTTTCAAGAAA
TGACAACTATTGAGGTTACGACGAACTTAATTTTCAAATATAACCTACAA
ATAACTACCGACGACATATTCACGTTTGTTGATGGCGAATGGCTTAACGA
CGCGATCATCAACTTTTACATGTCCATGCTGACGGAACGCTCGGAGAAGC
GAGCTGGCGAACTTCCCGCCACTTACGCCATGAACACATTCTTCATGCCC
CGTCTCCTGCAAGCTGGGTATGCAGGCGTTAGGCGCTGGACTCGCAAAGT
GGACTTGTTCAGCAAGGACATAATACCGGTGCCAGTGCACTGCGGCAACG
TCCACTGGTGCATGGCCATCATACACTTGCGTAACAAGACAATCTTCTAT
TACGACTCAATGGGAAGACCAAACCAACCGGCGCTTGATGCTCTAGTTAA
ATATCTGCACGAAGAGTCACTAGACAAGCGCAAACAGCCGTTTGATATGA
CCGGTTTCGTTGTCGAGAACGCGCAGAATATACCACGTCAAGGGAATAGC
AGCGATTGCGGTGTCTTCAGCTGCATGTTCGCCGAGTATATAACGCGTGA
TGTTCCGATTACCTTCTCCCAGGCGGAAATGTTGTACTTCCGCACGAAGA
TGGCCCTGGAAATCGCCGACGGAAAGTTGTGGCAGTAGGGGTTCAAGCAC
AAAACTACGCAAAAATGGAGAATTCAGTTCTTTACTTATTTTTACAAATC
TTACGTAAACACTCCAAGCATGAATTCGCGACAAGTACTTAGCCATCGAA
CGAACTCGTTTATTCGATAGAATCGAGATGGCTGAGACCCCTGCTGGTGC
ATTAACTTGTTCTCATATCTGATTGTAAAAGAGAATCTATTTCTTCAATA
AAATGTCACCAAGTAAAAGCGATGCGAATAAGGATGTATTAATCGCCGAA
TATCTTCAAGTTTATAATTAATATTTAGAATACAGCAAGCTATGAATATG
TACTAATGTAATGTAATGTACTGCTCTAATCCTAACTCTAAACTAGGAAT
TACTGGATTTCATATTTTTTTCTTACATTGTCTTTTCTGTTTCATATCGT
TAAGTTGAAAAGATCAGAGCCGCTGATAATTGAAAATCATACTAATACTC
CAGTTTATTTTTGAATTTATCGGTTTTTTTTTTTTAAAGAAAATGTCGCT
ATATTCCTATAAATTAGATAATATTAATAAGGAATCAATCTTAATTTAGT
ATTTTTGAAAATGTAGCTTATTCAAGCAAATACTTATTATACAAATATAG
GTAAATGTGGGTTAATGGTATTAGTTTTGTTTTTGTAAAGATTTTCTCTA
ACCCTTAGGAAGTAGTACACCTTTCATAACCTAAGGTACATAATGTAATA
TAATTTATTTTTGCAGAGCGAACTAAACAGAAATATATATTAAACAAAAA
ATATATGAAAAAAAAAAAAAAAAAAAAAAAAA

GH15225.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Ulp1.a 5497 Ulp1.a 89..5497 1..5408 27005 99.9 Plus
Ulp1-RA 5266 Ulp1-RA 127..5261 1..5135 25675 100 Plus
CG11023.b 2199 CG11023.b 1162..1770 4030..4638 1815 86.5 Plus
CG11023.b 2199 CG11023.b 137..357 2783..3003 685 87.3 Plus
CG11023.b 2199 CG11023.b 367..591 3001..3225 570 83.5 Plus
CG11023.b 2199 CG11023.b 1878..2058 4770..4950 530 86.1 Plus
CG11023.b 2199 CG11023.b 891..1059 3837..4005 275 77.5 Plus
CG11023.b 2199 CG11023.b 1806..1868 4681..4743 270 95.2 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19093973..19096693 2783..63 13500 99.7 Minus
chrX 22417052 chrX 19091002..19092387 5407..4023 6850 99.8 Minus
chrX 22417052 chrX 19092964..19093837 3656..2783 4310 99.5 Minus
chr2L 23010047 chr2L 8674..9567 4030..4950 2205 83.9 Plus
chr2L 23010047 chr2L 7573..8027 2783..3225 1070 82.9 Plus
chrX 22417052 chrX 19092466..19092667 4023..3822 995 99.5 Minus
chrX 22417052 chrX 19092726..19092891 3822..3657 830 100 Minus
chrX 22417052 chrX 19096930..19096996 67..1 320 98.5 Minus
chr2L 23010047 chr2L 8403..8571 3837..4005 275 77.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Ulp1-RA 4542 CG12359-PA 1..4542 97..4638 22710 100 Plus
CG11023-RC 1443 CG11023-PC 648..1442 3837..4631 1980 83.3 Plus
CG11023-RC 1443 CG11023-PC 1..348 2890..3225 760 81.9 Plus
CG11023-RD 819 CG11023-PD 1..348 2890..3225 760 81.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:53:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Ulp1-RA 5498 CG12359-RA 92..5498 1..5406 26985 100 Plus
CG11023-RC 1802 CG11023-RC 799..1802 3837..4864 2220 81.9 Plus
CG11023-RD 1844 CG11023-RD 1034..1844 4030..4864 2035 84 Plus
CG11023-RC 1802 CG11023-RC 45..499 2783..3225 1085 83.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Ulp1-PA 1513 CG12359-PA 1..1513 97..4635 7032 100 Plus
CG11023-PC 480 CG11023-PC 143..480 3646..4629 1140 64.5 Plus
CG32110-PA 411 CG32110-PA 111..411 3706..4635 717 47.1 Plus
CG11023-PC 480 CG11023-PC 1..132 2890..3267 442 68.2 Plus
CG11023-PD 272 CG11023-PD 1..132 2890..3267 442 68.2 Plus
CG11023-PB 284 CG11023-PB 1..132 2890..3267 442 68.2 Plus
CG11023-PD 272 CG11023-PD 143..266 3673..4023 269 46.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19205073..19207793 2783..63 13605 100 Minus
X 23542271 X 19202098..19203487 5411..4023 6900 99.9 Minus
X 23542271 X 19204064..19204937 3656..2783 4370 100 Minus
2L 23513712 2L 8674..9570 4030..4950 2285 84.2 Plus
2L 23513712 2L 7573..8027 2783..3225 1085 83.1 Plus
X 23542271 X 19203566..19203767 4023..3822 1010 100 Minus
X 23542271 X 19203826..19203991 3822..3657 830 100 Minus
X 23542271 X 19208030..19208096 67..1 320 98.5 Minus
2L 23513712 2L 8403..8571 3837..4005 275 77.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19213171..19215891 2783..63 13605 100 Minus
X 23527363 X 19210196..19211585 5411..4023 6910 99.9 Minus
X 23527363 X 19212162..19213035 3656..2783 4370 100 Minus
2L 23513712 2L 8674..9282 4030..4638 1815 86.5 Plus
X 23527363 X 19211664..19211865 4023..3822 1010 100 Minus
X 23527363 X 19211924..19212089 3822..3657 830 100 Minus
2L 23513712 2L 7573..7793 2783..3003 685 87.3 Plus
2L 23513712 2L 7803..8027 3001..3225 570 83.5 Plus
2L 23513712 2L 9390..9570 4770..4950 530 86.1 Plus
X 23527363 X 19216128..19216194 67..1 320 98.5 Minus
2L 23513712 2L 8403..8571 3837..4005 275 77.5 Plus
2L 23513712 2L 9318..9380 4681..4743 270 95.2 Plus
Blast to na_te.dros performed 2014-11-26 23:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1222..1290 5146..5080 124 66.7 Minus
accord2 7650 accord2 QBERT 7650bp 327..594 5097..5362 121 54.5 Plus

GH15225.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:23:13 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19096934..19096996 1..63 100   Minus
chrX 19093973..19096692 64..2783 99 <- Minus
chrX 19093023..19093836 2784..3597 99 <- Minus
chrX 19092727..19092891 3657..3821 100 == Minus
chrX 19092466..19092667 3822..4023 99 <- Minus
chrX 19091002..19092386 4024..5407 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:44:16 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 1..4542 97..4638 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:01:57 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 1..4542 97..4638 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:31:49 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 1..4542 97..4638 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:47:22 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 1..4542 97..4638 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:23:13 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 1..4542 97..4638 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:46:58 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 89..4959 1..4871 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:01:57 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 89..4959 1..4871 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:31:49 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 89..4959 1..4871 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:47:22 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 89..4959 1..4871 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:23:13 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 92..5498 1..5406 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:23:13 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
X 19208034..19208096 1..63 100   Minus
X 19205073..19207792 64..2783 100 <- Minus
X 19204064..19204936 2784..3656 100 <- Minus
X 19203827..19203991 3657..3821 100 <- Minus
X 19203566..19203767 3822..4023 100 <- Minus
X 19202102..19203486 4024..5407 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:31:49 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19102067..19102129 1..63 100   Minus
arm_X 19099106..19101825 64..2783 100 <- Minus
arm_X 19098097..19098969 2784..3656 100 <- Minus
arm_X 19097860..19098024 3657..3821 100 <- Minus
arm_X 19097599..19097800 3822..4023 100 <- Minus
arm_X 19096135..19097519 4024..5407 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:53:53 Download gff for GH15225.complete
Subject Subject Range Query Range Percent Splice Strand
X 19216132..19216194 1..63 100   Minus
X 19213171..19215890 64..2783 100 <- Minus
X 19212162..19213034 2784..3656 100 <- Minus
X 19211925..19212089 3657..3821 100 <- Minus
X 19211664..19211865 3822..4023 100 <- Minus
X 19210200..19211584 4024..5407 99 <- Minus

GH15225.hyp Sequence

Translation from 0 to 4637

> GH15225.hyp
KLRKFSQVTVKSVHCLKPGQGLKVAKAVANTRMSLPPEDTDLSTNSAYES
ALQIASNVSAARVVGSAVGQRFSPSPAAHPNVIERVASHVDSRRSTFPSW
GNPSVAPRGSEEAAANATATQLLWAENQGLPTSHLLPTEQAFETLNTNAY
CSPPGDSRFTFPSQNYSPLLPRCVPVPNQRYSPDGSPIHQLHELQNCPLI
DSPIRLRFPSPLPEPPSLPTITLTVDALIDLDQNNQVAYYVQQYNNQPVL
YQQNIHIGTGIQLCDQASENNQPIILHIVEHNPQTITESQEQFHQVVPEI
QINNIQEQDQKFENGISEQNHPIATEAQDQTLTEIRDENQIVLAVQEKNL
TRASEIQDQNQQTLTEIPEKCLQIASPVTTDIQVQSPQVVIEIQEQNHQS
VTEIQEEVHQTAPEIQVNVFQTSSDIQGQNHQIVTEEQNHQTITETQEDY
SAVSEIQWENLSFSAEIQEQNQQIVTEVTKLASPSVTDIQAQSPQSVIEI
QDDDDEDLKFESDDLHTIPEIQEKNQQSPQFVIEIHYDNEDLKFASDNQE
QDQQTAELQKERFQFASEIEKRDLQIVTDTHKQNYHNVTDIPFATYIQEE
NEQLTPEDQEEDQHYLNFEGNQQFQLQKQDQLSVPQIQKQTHQFESKVKK
RKLQPFSEYQQKGQKDHIQERQYIQQEFTIHSNQAYSKVQYIQTIQTATP
YVPQLEISQENSFEVQPAYEVNEGQRDRELVSYTGHEHQNFVDEVSTPLP
PAEAQPGSTSEDISDPVSPEHWEQLESLDPSTICIRKTFNLIRDISESLV
ADPEQPEAEAHRKSIFLLRQKLADVCHKVLTEIIHGRATDEIISILREIL
EQTKEIPPRPTPKRDLQEDISMGLEILKKIRGMLSGWYSSRESETDSTDT
GTGFQAQNGKGFGAGRQPENSFLSQKRRNQEENPRLIKYRRVDNSFPRLI
TNETAEDLIPNNSMAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPTPF
DDEESSQRLANAGPSSRPMTYSDAVRLGHNGISESRVNGHSSHTVRREPS
RLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTPPTFQRAKAQS
ATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAP
QQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKE
ANEANEANEANEANETKENDAPQPTTTRIKKPDFLHRRFANCIFLRNDFA
ENFKARANRRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGAPH
RPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQ
ITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMP
RLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFY
YDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNS
SDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKLWQ*

GH15225.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
Ulp1-PA 1513 CG12359-PA 1..1513 33..1545 7882 100 Plus
CG11023-PC 480 CG11023-PC 128..480 1201..1543 1156 62.6 Plus
CG32110-PA 411 CG32110-PA 111..411 1236..1545 717 47.1 Plus
CG11023-PC 480 CG11023-PC 1..132 964..1089 442 68.2 Plus
CG11023-PD 272 CG11023-PD 1..132 964..1089 442 68.2 Plus
CG11023-PB 284 CG11023-PB 1..132 964..1089 442 68.2 Plus
CG11023-PD 272 CG11023-PD 114..266 1198..1341 273 40.5 Plus

GH15225.pep Sequence

Translation from 96 to 4637

> GH15225.pep
MSLPPEDTDLSTNSAYESALQIASNVSAARVVGSAVGQRFSPSPAAHPNV
IERVASHVDSRRSTFPSWGNPSVAPRGSEEAAANATATQLLWAENQGLPT
SHLLPTEQAFETLNTNAYCSPPGDSRFTFPSQNYSPLLPRCVPVPNQRYS
PDGSPIHQLHELQNCPLIDSPIRLRFPSPLPEPPSLPTITLTVDALIDLD
QNNQVAYYVQQYNNQPVLYQQNIHIGTGIQLCDQASENNQPIILHIVEHN
PQTITESQEQFHQVVPEIQINNIQEQDQKFENGISEQNHPIATEAQDQTL
TEIRDENQIVLAVQEKNLTRASEIQDQNQQTLTEIPEKCLQIASPVTTDI
QVQSPQVVIEIQEQNHQSVTEIQEEVHQTAPEIQVNVFQTSSDIQGQNHQ
IVTEEQNHQTITETQEDYSAVSEIQWENLSFSAEIQEQNQQIVTEVTKLA
SPSVTDIQAQSPQSVIEIQDDDDEDLKFESDDLHTIPEIQEKNQQSPQFV
IEIHYDNEDLKFASDNQEQDQQTAELQKERFQFASEIEKRDLQIVTDTHK
QNYHNVTDIPFATYIQEENEQLTPEDQEEDQHYLNFEGNQQFQLQKQDQL
SVPQIQKQTHQFESKVKKRKLQPFSEYQQKGQKDHIQERQYIQQEFTIHS
NQAYSKVQYIQTIQTATPYVPQLEISQENSFEVQPAYEVNEGQRDRELVS
YTGHEHQNFVDEVSTPLPPAEAQPGSTSEDISDPVSPEHWEQLESLDPST
ICIRKTFNLIRDISESLVADPEQPEAEAHRKSIFLLRQKLADVCHKVLTE
IIHGRATDEIISILREILEQTKEIPPRPTPKRDLQEDISMGLEILKKIRG
MLSGWYSSRESETDSTDTGTGFQAQNGKGFGAGRQPENSFLSQKRRNQEE
NPRLIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPP
VYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLGHNGI
SESRVNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGS
RYLKPGTPPTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTE
YAKLINRQENEENRSPAPQQPKRNASNSSASHASTISSSASSSCSTCSTC
SSSDTEPMLVKDSPEVKEANEANEANEANEANETKENDAPQPTTTRIKKP
DFLHRRFANCIFLRNDFAENFKARANRRQLESMHLLGIAEQQANESKDER
LAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQ
EMTTIEVTTNLIFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSE
KRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCG
NVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFD
MTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRT
KMALEIADGKLWQ*

GH15225.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16000-PA 1044 GF16000-PA 248..1043 742..1512 1410 39.6 Plus
Dana\GF11094-PA 529 GF11094-PA 184..528 1160..1511 750 42.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18071-PA 1465 GG18071-PA 1..1465 1..1513 3388 49.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12462-PA 851 GH12462-PA 179..850 840..1512 943 34.6 Plus
Dgri\GH22500-PA 187 GH22500-PA 2..185 1326..1511 529 52.9 Plus
Dgri\GH23754-PA 187 GH23754-PA 2..185 1326..1511 528 52.4 Plus
Dgri\GH12570-PA 199 GH12570-PA 2..199 1315..1513 521 51 Plus
Dgri\GH23753-PA 187 GH23753-PA 2..185 1326..1511 520 51.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Ulp1-PA 1513 CG12359-PA 1..1513 1..1513 7882 100 Plus
CG11023-PC 480 CG11023-PC 128..480 1169..1511 1156 62.6 Plus
CG32110-PA 411 CG32110-PA 111..411 1204..1513 717 47.1 Plus
CG11023-PC 480 CG11023-PC 1..132 932..1057 442 68.2 Plus
CG11023-PD 272 CG11023-PD 1..132 932..1057 442 68.2 Plus
CG11023-PB 284 CG11023-PB 1..132 932..1057 442 68.2 Plus
CG11023-PD 272 CG11023-PD 114..266 1166..1309 273 40.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:03:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11140-PA 836 GI11140-PA 82..835 782..1512 981 35.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 22:03:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22451-PA 172 GL22451-PA 1..172 1342..1513 593 59.3 Plus
Dper\GL12699-PA 304 GL12699-PA 123..303 1331..1511 541 50.3 Plus
Dper\GL12849-PA 206 GL12849-PA 55..205 1275..1425 438 51.7 Plus
Dper\GL13014-PA 1499 GL13014-PA 699..1049 768..1041 210 28 Plus
Dper\GL13015-PA 712 GL13015-PA 1..262 840..1041 188 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24323-PA 297 GA24323-PA 59..297 1275..1513 684 52.3 Plus
Dpse\GA28657-PA 270 GA28657-PA 55..270 1275..1512 614 50.4 Plus
Dpse\GA27591-PA 304 GA27591-PA 123..303 1331..1511 542 50.3 Plus
Dpse\GA25857-PA 2001 GA25857-PA 1203..1554 768..1042 212 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 22:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22759-PA 1037 GM22759-PA 1..518 1..559 1866 71.8 Plus
Dsec\GM22759-PA 1037 GM22759-PA 226..890 357..1066 1648 52.5 Plus
Dsec\GM22760-PA 172 GM22760-PA 1..172 1342..1513 837 86 Plus
Dsec\GM22759-PA 1037 GM22759-PA 889..1034 1180..1325 531 67.8 Plus
Dsec\GM11534-PA 848 GM11534-PA 548..748 1316..1480 184 28 Plus
Dsec\GM11948-PA 917 GM11948-PA 618..817 1317..1480 172 30.3 Plus
Dsec\GM10411-PA 327 GM10411-PA 27..227 1316..1480 163 29.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 22:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15595-PA 979 GD15595-PA 225..973 560..1312 2565 69.7 Plus
Dsim\GD15595-PA 979 GD15595-PA 1..274 1..287 972 71.4 Plus
Dsim\GD15596-PA 170 GD15596-PA 1..170 1344..1513 821 84.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18697-PA 899 GJ18697-PA 124..898 747..1512 1056 35.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 22:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10155-PA 1064 GK10155-PA 728..1063 1174..1512 1006 53.2 Plus
Dwil\GK18884-PA 211 GK18884-PA 9..210 1311..1512 616 54 Plus
Dwil\GK10155-PA 1064 GK10155-PA 132..525 747..1041 275 30.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15468-PA 1524 GE15468-PA 1..1524 1..1513 3700 53.1 Plus