Clone GH18452 Report

Search the DGRC for GH18452

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:184
Well:52
Vector:pOT2
Associated Gene/TranscriptEts65A-RB
Protein status:GH18452.pep: gold
Preliminary Size:2124
Sequenced Size:2180

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7018 2001-07-04 Blastp of sequenced clone
CG7018 2003-01-01 Sim4 clustering to Release 3
Ets65A 2008-04-29 Release 5.5 accounting
Ets65A 2008-08-15 Release 5.9 accounting
Ets65A 2008-12-18 5.12 accounting

Clone Sequence Records

GH18452.complete Sequence

2180 bp (2180 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060316

> GH18452.complete
CCACAGATCGGACGCAATCCGGTGTCAGTGCTCAAGCTCGATAGTCCTAG
CCAGGAGCATCCTTTCTTAGTCCTTCTCAGTGATTTACGCGATTCTCGCT
GGGCCTACCCACACATATACAACTACAAATACAAGCAGAAACAGTACAAG
TGCTGAAAAAATATCACGTATACGTGCGGGGACATTGACACATATAAATC
AGTTGGACACGCGAACGGCAGGCAGGTCGAAAAGTGCATTGGAAAGTTCG
GGCGGAAGTCGAGGTGTCCGGTAAACGGTAACCGGTTCCGATCGTCACTT
TTCCCGTTCCCGTTCCTTTTCCTGTTCCGCTGCGCGTCGCTGCTCCACCG
CTGCCCATTTGCCCGTTTGACTTTTTTTAAACAAATTCAATTGCGGACAC
CACTTGGCGACGTCTCCGTCTCCGTGTTATTAGTTTCCGGCCTCCGGCGA
CCAATTTACCGCTTGCCAAAAAAAGAGAAACAGGACAACACAGAGAGTGC
GACAAGGACAAAGACCAAAAGCAATTTGAATTCGAATTTGAATTTGAAAT
CCTAACTAATTGCTGTGTGTGTGTGTGTGTGCGTCAGAGGTGTGGAACGG
AACAAGCAACCGAATACCCAACCGACGGCGGCCACAATGCTGGACATCAA
GTCCTCCGCCGATTACTTGTCACGCTCCACGGGCAGCTTCAGCAACTTCT
CGATGCTCTTCGCAGATTCCTCGTACAAATCGTCGTGGGGCTCCCACAGT
TCGACACAATCGCAAGGTTACAGCTCGAACGCCCTGGGCATCAAACATGA
TCCGCACTCACAACTACGGCAACCTGATCCATATCAAATGTTCGGACCCA
CCAGCAGCAGACTGGCCAGCTCAGGCTCTGGCCAAATCCAGCTGTGGCAG
TTCCTTCTCGAGCTGCTCTCGGACTCCAATAACGCCAGCTGCATCACCTG
GGAGGGCACCAACGGCGAGTTTAAGCTAACCGATCCCGACGAGGTCGCCC
GCCGCTGGGGCGAGAGGAAGTCCAAGCCCAACATGAACTACGATAAGCTC
AGTCGCGCCTTGAGGTACTACTACGACAAAAATATAATGACCAAGGTGCA
CGGCAAGCGGTATGCGTACAAATTCGATTTCCAAGGCCTGGCAGCTGCTA
CTCAGCCGGCGGCCAGCGATCCCACCTACAAATACCAGAGCGACTTGTTC
ATGACACCATATCACCACAGCGCCAAGCTCAGCTCGTTCATGAGTCCGCA
TCATGGCATGACCTCATCCTCGGCCTCGATCTTCCCGTCGGCCGCCTCGT
GGGGCAACTGGGGCAGTCCGGCCACGAATCTCTACCAGCCGCACTCGATG
AGCCACGTGACCCCCTCCCACGTAGCGCCCCACCTGAGCAGCTATCCCCA
CTACGCATGACCATCATCGTCCGGTGGCGCCTTCTAATATGAGAGCAACG
CCATCGCCAGTGCCTCGGGCATTGGCGGCGGCACGGCCTCGACGGGCGTG
GGCATCGGCGGAGTGGGCGGTGCAGGTGGCGGAGGTGGATCCGGGGTGTC
CACCGGAGTGGGCTCCACCTCGAGCAGTACCACCAGCAGTGGAGCTGGTG
GCGGAGGCGGTGGCGGTGGTGGTACGGTCATGAGTGGTTTCGGAAGCAAT
GGCAACCTGAACGGATCCCATGTGTCCAGCAGCGGTGGGTCGTCCAGTGT
GAGCAACAACCTCAATATTGCCACGGCCACGTTGACGGCGACACCGGCTC
ATGCCAGTGCCGGATTTGGGACAATTGGCGGGCTCAGTGTGGCCGGAATG
GGCGTGGGCGTGGGGGTCGGAGTGGGCGTGGGCGGTGGTAATTCAACGCT
CAATTCATTGGTAGTAGGCAACCGGCTAATGAACAGCAGCCTGCCGACGC
TGCTCAAATGATGCCACTTGGAGAAGTTCGGGCTGACGATGGGCGCAGGT
CCTTCGCCGCCGGCTGCAACGCCCGCTGGCGAAAATATGCCACCGTACCA
CCATCACGGTCATCCCGCCCACTCCGGACTTCCAGGACACGCTGGCAACT
ATGGGGCCAACGAGCGGGCTCTGTACGATTATCTGGACATGAAGAGCGGC
GAACAGGCCACGTTTTTACTGTAAATGCAAAAAGGCAAAACTTGTAACCA
GAACCACCAGAAAAAAAAAAAAAAAAAAAA

GH18452.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-RB 3550 Ets65A-RB 323..2502 1..2180 10825 99.7 Plus
Ets65A.b 4257 Ets65A.b 1745..3209 716..2180 7250 99.6 Plus
Ets65A-RA 3817 Ets65A-RA 1305..2769 716..2180 7250 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6114531..6115418 1273..2160 4440 100 Plus
chr3L 24539361 chr3L 6104116..6104830 1..715 3545 99.7 Plus
chr3L 24539361 chr3L 6114048..6114258 1063..1273 1025 99.1 Plus
chr3L 24539361 chr3L 6111535..6111729 872..1066 915 97.9 Plus
chr3L 24539361 chr3L 6106921..6106982 765..826 310 100 Plus
chr3L 24539361 chr3L 6105000..6105055 713..768 280 100 Plus
chr2L 23010047 chr2L 547996..548165 1049..880 280 77.6 Minus
chr3L 24539361 chr3L 6108568..6108617 826..875 250 100 Plus
chr2L 23010047 chr2L 547828..547905 1140..1063 240 87.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-RE 2187 CG7018-PE 779..2187 716..2124 7045 100 Plus
Ets65A-RD 1974 CG7018-PD 779..1974 716..1911 5980 100 Plus
Ets65A-RB 774 CG7018-PB 1..774 637..1410 3870 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:58:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-RB 2177 CG7018-RB 18..2177 1..2160 10800 100 Plus
Ets65A-RE 4190 CG7018-RE 1695..3139 716..2160 7225 100 Plus
Ets65A-RD 4190 CG7018-RD 1695..3139 716..2160 7225 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-PB 257 CG7018-PB 1..248 637..1380 1139 100 Plus
Ets65A-PD 657 CG7018-PD 281..506 778..1455 1042 99.1 Plus
Ets65A-PE 728 CG7018-PE 281..506 778..1455 1042 99.1 Plus
Ets65A-PA 490 CG7018-PA 281..481 778..1380 1027 100 Plus
Ets65A-PC 512 CG7018-PC 303..503 778..1380 1027 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6121975..6122882 1273..2180 4465 99.4 Plus
3L 28110227 3L 6111484..6112198 1..715 3575 100 Plus
3L 28110227 3L 6121492..6121702 1063..1273 1055 100 Plus
3L 28110227 3L 6118956..6119150 872..1066 975 100 Plus
3L 28110227 3L 6114292..6114353 765..826 310 100 Plus
3L 28110227 3L 6112368..6112423 713..768 280 100 Plus
2L 23513712 2L 547993..548162 1049..880 280 77.6 Minus
3L 28110227 3L 6115954..6116003 826..875 250 100 Plus
2L 23513712 2L 547825..547902 1140..1063 240 87.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6115075..6115982 1273..2180 4465 99.4 Plus
3L 28103327 3L 6104584..6105298 1..715 3575 100 Plus
3L 28103327 3L 6114592..6114802 1063..1273 1055 100 Plus
3L 28103327 3L 6112056..6112250 872..1066 975 100 Plus
3L 28103327 3L 6107392..6107453 765..826 310 100 Plus
3L 28103327 3L 6105468..6105523 713..768 280 100 Plus
2L 23513712 2L 547993..548162 1049..880 280 77.6 Minus
3L 28103327 3L 6109054..6109103 826..875 250 100 Plus
2L 23513712 2L 547825..547902 1140..1063 240 87.1 Minus
Blast to na_te.dros performed on 2014-11-27 03:37:25 has no hits.

GH18452.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:38:18 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6114532..6115418 1274..2160 95   Plus
chr3L 6114050..6114258 1065..1273 99 -> Plus
chr3L 6111538..6111727 875..1064 97 -> Plus
chr3L 6108569..6108616 827..874 100 -> Plus
chr3L 6106923..6106982 767..826 100 -> Plus
chr3L 6105003..6105053 716..766 100 -> Plus
chr3L 6104116..6104830 1..715 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:08:50 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 1..774 637..1410 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:25:37 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 1..774 637..1410 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:58 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 1..774 637..1410 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:58:37 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 1..774 637..1410 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:38:18 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RE 767..2187 705..2124 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:08:47 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 270..2429 1..2160 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:25:37 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 270..2429 1..2160 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:58 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 18..2177 1..2160 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:58:37 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 270..2429 1..2160 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:38:18 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 18..2177 1..2160 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:38:18 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6121976..6122862 1274..2160 100   Plus
3L 6121494..6121702 1065..1273 100 -> Plus
3L 6118959..6119148 875..1064 100 -> Plus
3L 6115955..6116002 827..874 100 -> Plus
3L 6114294..6114353 767..826 100 -> Plus
3L 6112371..6112421 716..766 100 -> Plus
3L 6111484..6112198 1..715 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:58 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6115076..6115962 1274..2160 100   Plus
arm_3L 6114594..6114802 1065..1273 100 -> Plus
arm_3L 6112059..6112248 875..1064 100 -> Plus
arm_3L 6109055..6109102 827..874 100 -> Plus
arm_3L 6107394..6107453 767..826 100 -> Plus
arm_3L 6105471..6105521 716..766 100 -> Plus
arm_3L 6104584..6105298 1..715 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:36:27 Download gff for GH18452.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6115076..6115962 1274..2160 100   Plus
3L 6114594..6114802 1065..1273 100 -> Plus
3L 6112059..6112248 875..1064 100 -> Plus
3L 6109055..6109102 827..874 100 -> Plus
3L 6107394..6107453 767..826 100 -> Plus
3L 6105471..6105521 716..766 100 -> Plus
3L 6104584..6105298 1..715 100 -> Plus

GH18452.pep Sequence

Translation from 636 to 1409

> GH18452.pep
MLDIKSSADYLSRSTGSFSNFSMLFADSSYKSSWGSHSSTQSQGYSSNAL
GIKHDPHSQLRQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNA
SCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNI
MTKVHGKRYAYKFDFQGLAAATQPAASDPTYKYQSDLFMTPYHHSAKLSS
FMSPHHGMTSSSASIFPSAASWGNWGSPATNLYQPHSMSHVTPSHVAPHL
SSYPHYA*

GH18452.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23517-PA 408 GF23517-PA 1..245 1..245 1327 99.2 Plus
Dana\GF24707-PA 594 GF24707-PA 336..449 64..176 506 79.8 Plus
Dana\GF18561-PA 463 GF18561-PA 337..425 76..164 346 66.3 Plus
Dana\GF18013-PA 639 GF18013-PA 526..621 79..172 316 67.7 Plus
Dana\GF23047-PA 640 GF23047-PA 496..578 82..163 310 62.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15322-PA 406 GG15322-PA 1..245 1..245 1336 100 Plus
Dere\GG24643-PA 481 GG24643-PA 225..359 49..180 494 69.6 Plus
Dere\GG12163-PA 464 GG12163-PA 330..426 69..164 351 62.9 Plus
Dere\GG12443-PA 649 GG12443-PA 536..631 79..172 315 67.7 Plus
Dere\GG11319-PA 693 GG11319-PA 539..631 72..163 310 58.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15833-PA 257 GH15833-PA 1..257 1..257 1329 97.3 Plus
Dgri\GH10509-PA 498 GH10509-PA 228..362 49..180 506 70.4 Plus
Dgri\GH14255-PA 492 GH14255-PA 364..452 76..164 350 66.3 Plus
Dgri\GH20735-PA 664 GH20735-PA 551..646 79..172 316 67.7 Plus
Dgri\GH19112-PA 647 GH19112-PA 504..586 82..163 305 61.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-PB 257 CG7018-PB 1..257 1..257 1382 100 Plus
Ets65A-PA 490 CG7018-PA 261..490 28..257 1250 100 Plus
Ets65A-PC 512 CG7018-PC 283..512 28..257 1250 100 Plus
Ets65A-PD 657 CG7018-PD 261..490 28..257 1250 100 Plus
Ets65A-PE 728 CG7018-PE 261..490 28..257 1250 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12615-PA 257 GI12615-PA 1..257 1..257 1345 98.8 Plus
Dmoj\GI18027-PA 511 GI18027-PA 234..367 49..179 508 70.1 Plus
Dmoj\GI23149-PA 473 GI23149-PA 346..434 76..164 350 66.3 Plus
Dmoj\GI23211-PA 657 GI23211-PA 544..639 79..172 317 67.7 Plus
Dmoj\GI23566-PA 642 GI23566-PA 497..579 82..163 305 61.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15553-PA 257 GL15553-PA 1..257 1..257 1347 99.2 Plus
Dper\GL19256-PA 503 GL19256-PA 232..361 48..176 488 69.2 Plus
Dper\GL27261-PA 463 GL27261-PA 337..425 76..164 343 64 Plus
Dper\GL23032-PA 628 GL23032-PA 515..610 79..172 316 67.7 Plus
Dper\GL13628-PA 672 GL13628-PA 528..610 82..163 314 63.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23445-PA 257 GA23445-PA 1..257 1..257 1347 99.2 Plus
Dpse\GA15514-PA 503 GA15514-PA 232..361 48..176 488 69.2 Plus
Dpse\GA19521-PA 462 GA19521-PA 336..424 76..164 343 64 Plus
Dpse\GA30133-PC 758 GA30133-PC 645..740 79..172 315 67.7 Plus
Dpse\GA19934-PA 669 GA19934-PA 525..607 82..163 314 63.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14757-PA 373 GM14757-PA 1..220 1..240 1144 91.7 Plus
Dsec\GM23994-PA 187 GM23994-PA 1..120 23..142 651 100 Plus
Dsec\GM16660-PA 475 GM16660-PA 219..347 49..176 493 71.3 Plus
Dsec\GM10156-PA 464 GM10156-PA 338..426 76..164 351 66.3 Plus
Dsec\pnt-PA 627 GM23575-PA 514..609 79..172 315 67.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13937-PA 257 GD13937-PA 1..257 1..257 1357 100 Plus
Dsim\GD18111-PA 464 GD18111-PA 338..426 76..164 351 66.3 Plus
Dsim\GD18390-PA 355 GD18390-PA 242..337 79..172 311 67.7 Plus
Dsim\GD21130-PA 675 GD21130-PA 531..613 82..163 309 62.7 Plus
Dsim\GD22871-PA 716 GD22871-PA 380..460 86..163 212 49.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12736-PA 257 GJ12736-PA 1..257 1..257 1348 98.8 Plus
Dvir\GJ19705-PA 505 GJ19705-PA 218..346 49..176 505 71.3 Plus
Dvir\GJ10451-PA 469 GJ10451-PA 342..430 76..164 349 66.3 Plus
Dvir\GJ22870-PA 658 GJ22870-PA 545..640 79..172 316 67.7 Plus
Dvir\GJ23541-PA 627 GJ23541-PA 485..567 82..163 305 61.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17265-PA 399 GK17265-PA 1..250 1..250 1313 98 Plus
Dwil\GK24433-PA 401 GK24433-PA 163..297 49..180 510 69.6 Plus
Dwil\GK22561-PA 470 GK22561-PA 342..432 74..164 354 65.9 Plus
Dwil\GK12243-PA 672 GK12243-PA 559..654 79..172 314 67.7 Plus
Dwil\GK14107-PA 697 GK14107-PA 488..633 26..163 310 45.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21541-PA 399 GE21541-PA 1..240 1..240 1310 100 Plus
Dyak\GE16051-PA 475 GE16051-PA 219..347 49..176 493 71.3 Plus
Dyak\GE10607-PA 464 GE10607-PA 330..426 69..164 355 63.9 Plus
Dyak\GE23966-PA 636 GE23966-PA 523..618 79..172 315 67.7 Plus
Dyak\GE23515-PA 649 GE23515-PA 503..585 82..163 312 62.7 Plus

GH18452.hyp Sequence

Translation from 636 to 1409

> GH18452.hyp
MLDIKSSADYLSRSTGSFSNFSMLFADSSYKSSWGSHSSTQSQGYSSNAL
GIKHDPHSQLRQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNA
SCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNI
MTKVHGKRYAYKFDFQGLAAATQPAASDPTYKYQSDLFMTPYHHSAKLSS
FMSPHHGMTSSSASIFPSAASWGNWGSPATNLYQPHSMSHVTPSHVAPHL
SSYPHYA*

GH18452.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-PB 257 CG7018-PB 1..257 1..257 1382 100 Plus
Ets65A-PA 490 CG7018-PA 261..490 28..257 1250 100 Plus
Ets65A-PC 512 CG7018-PC 283..512 28..257 1250 100 Plus
Ets65A-PD 657 CG7018-PD 261..490 28..257 1250 100 Plus
Ets65A-PE 728 CG7018-PE 261..490 28..257 1250 100 Plus