Clone GH18623 Report

Search the DGRC for GH18623

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:186
Well:23
Vector:pOT2
Associated Gene/TranscriptCG17912-RA
Protein status:GH18623.pep: gold
Preliminary Size:1424
Sequenced Size:1316

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17912 2001-07-04 Blastp of sequenced clone
CG17912 2003-01-01 Sim4 clustering to Release 3
CG17912 2008-04-29 Release 5.5 accounting
CG17912 2008-08-15 Release 5.9 accounting
CG17912 2008-12-18 5.12 accounting

Clone Sequence Records

GH18623.complete Sequence

1316 bp (1316 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051534

> GH18623.complete
TCACTCTGACTGGCTCTCCATTTTGTTTTCCACGACAGAGCAATTTTTAG
TACAACAGATTGTTATCTTCTACCAATTACCGGATCGATTTTGTACATTT
AAGTGTTTTAAAGCCACCTTAGGATCATGGGACGCAAGAAGAAGAAGGCC
TCCAAACCCTGGTGCTGGTACTGCAACCGTGAGTTCGATGACGAAAAGAT
CCTTGTGCAGCACCAGAAGGCCAAGCACTTCAAATGCCACATCTGCCACA
AGAAGTTGTACACCGGACCCGGACTATCCATACACTGCATGCAGGTGCAC
AAGGAAACGGTGGACAAGGTCCCCAACTCGCTGCCCAATCGCTCAAATAT
TGAAGTCGAAATCTTTGGCATGGACGGCATTCCCGCCGAGGATCTCAGGG
ATCACGAACGTCAGAAGAATGGTGGCAAGTCTGATTCGGACGATGATGAA
CCGGTGGCCAAAAAGAAAGTAGAATATGCCATGAGTGTACCGCCGCCTAT
GATGATGCCCCCGAACATGATGCCACCGCACATGCTGGGGCAGTACGGCA
TGGGCATGATGCAGCACATGCCGCCACTGCCTCCGTATCCAGTGCCCATG
ATGCCGCACATGATGCCTCCGCGTCCTTTGTTTCCAGCCGCCATGGCCAC
AACATCGGCGGCAGCTGCTGCGGCGGCGGCCCATCATCACCACGCCGCCG
CCATGGCTCAACAAAAGCCAACATTTCCAGCGTACAGTAATGCTACCATA
AGTGCTCCGCCTACCACCAATCATGCTGGTGGCGCATCCAGCGCACCACC
AAGTGGTCCGCCAGATGCTCAGCAACACCAGCAGCGACCTCCAGCTCCAC
CGGCGGCAAGCGGAACTTCCGCTGCTGCTGTGACCACAAAGATTATGCAT
CCACAGGAGGACCTGAGTCTGGAAGAATTGCGCGCGCGCCAACCGAAAAT
ACAAGCACGGTTGGCGGCCGCTTTGGCTTCACTGGCGAATCCACAAAGTC
GCAAGAGTCCCAGCAACAATGGTGGCCCCTCTACGTCGATTCCCACCACT
CCGCCGCCCCCGTCGCTGGCCGGGATCTCGCCCACGGGTAGCAATAGCAG
CAGTGGCATGGCTAACTCGATTGTCGTCTCCGCAGCCATGTCGAAGGCCC
AGGAAGTGAGTTCTTATCATAGTTATAGAAACCATAGTCAATATAAATAA
ACAGACCGTGACGGAAACGACTTCCACTGATTAACAGGAAATGACAAGCA
CAACGGACTGAAACGAGGACGTGTAAAAAAGACAATTTCCTCCAAAAAAA
AAAAAAAAAAAAAAAA

GH18623.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-RA 1745 CG17912-RA 100..1405 1..1306 6515 99.9 Plus
CG17912.a 1607 CG17912.a 1..1300 1..1306 6400 99.4 Plus
CG17912.b 2700 CG17912.b 100..1254 1..1155 5775 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16743429..16743986 736..1293 2790 100 Plus
chr2L 23010047 chr2L 16742500..16742808 167..475 1545 100 Plus
chr2L 23010047 chr2L 16742865..16743126 476..737 1310 100 Plus
chr2L 23010047 chr2L 16742145..16742314 1..170 835 99.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-RA 1074 CG17912-PA 1..1074 127..1200 5370 100 Plus
CG17912-RD 1689 CG17912-PD 1..1029 127..1155 5145 100 Plus
CG17912-RC 1689 CG17912-PC 1..1029 127..1155 5145 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:58:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-RA 1612 CG17912-RA 1..1292 2..1293 6460 100 Plus
CG17912-RD 6091 CG17912-RD 1..1154 2..1155 5770 100 Plus
CG17912-RC 4400 CG17912-RC 1..1154 2..1155 5770 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-PA 357 CG17912-PA 1..357 127..1197 1101 100 Plus
CG17912-PG 476 CG17912-PG 1..343 127..1155 1023 100 Plus
CG17912-PD 562 CG17912-PD 1..343 127..1155 1023 100 Plus
CG17912-PC 562 CG17912-PC 1..343 127..1155 1023 100 Plus
CG17912-PB 562 CG17912-PB 1..343 127..1155 1023 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16744688..16745258 736..1306 2840 99.8 Plus
2L 23513712 2L 16743759..16744067 167..475 1545 100 Plus
2L 23513712 2L 16744124..16744385 476..737 1310 100 Plus
2L 23513712 2L 16743404..16743573 1..170 850 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16744688..16745258 736..1306 2840 99.8 Plus
2L 23513712 2L 16743759..16744067 167..475 1545 100 Plus
2L 23513712 2L 16744124..16744385 476..737 1310 100 Plus
2L 23513712 2L 16743404..16743573 1..170 850 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:08:19 has no hits.

GH18623.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:02:48 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16743431..16743986 738..1293 100   Plus
chr2L 16742865..16743126 476..737 100 -> Plus
chr2L 16742501..16742808 168..475 100 -> Plus
chr2L 16742145..16742311 1..167 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:48:15 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1074 127..1200 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:25:30 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1074 127..1200 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:58:18 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1074 127..1200 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:58:30 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1074 127..1200 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:02:48 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1074 127..1200 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:24:04 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1293 1..1293 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:25:30 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1293 1..1293 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:58:18 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1292 2..1293 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:58:30 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1293 1..1293 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:02:48 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1292 2..1293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:02:48 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16744690..16745245 738..1293 100   Plus
2L 16744124..16744385 476..737 100 -> Plus
2L 16743760..16744067 168..475 100 -> Plus
2L 16743404..16743570 1..167 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:58:18 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16744690..16745245 738..1293 100   Plus
arm_2L 16744124..16744385 476..737 100 -> Plus
arm_2L 16743760..16744067 168..475 100 -> Plus
arm_2L 16743404..16743570 1..167 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:36:19 Download gff for GH18623.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16744690..16745245 738..1293 100   Plus
2L 16744124..16744385 476..737 100 -> Plus
2L 16743760..16744067 168..475 100 -> Plus
2L 16743404..16743570 1..167 100 -> Plus

GH18623.pep Sequence

Translation from 126 to 1199

> GH18623.pep
MGRKKKKASKPWCWYCNREFDDEKILVQHQKAKHFKCHICHKKLYTGPGL
SIHCMQVHKETVDKVPNSLPNRSNIEVEIFGMDGIPAEDLRDHERQKNGG
KSDSDDDEPVAKKKVEYAMSVPPPMMMPPNMMPPHMLGQYGMGMMQHMPP
LPPYPVPMMPHMMPPRPLFPAAMATTSAAAAAAAAHHHHAAAMAQQKPTF
PAYSNATISAPPTTNHAGGASSAPPSGPPDAQQHQQRPPAPPAASGTSAA
AVTTKIMHPQEDLSLEELRARQPKIQARLAAALASLANPQSRKSPSNNGG
PSTSIPTTPPPPSLAGISPTGSNSSSGMANSIVVSAAMSKAQEVSSYHSY
RNHSQYK*

GH18623.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 17:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15358-PA 564 GF15358-PA 1..352 1..347 1088 83.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 17:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22767-PA 357 GG22767-PA 1..357 1..357 1416 97.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 17:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11562-PA 591 GH11562-PA 1..299 1..276 825 74.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-PA 357 CG17912-PA 1..357 1..357 1916 100 Plus
CG17912-PG 476 CG17912-PG 1..343 1..343 1838 100 Plus
CG17912-PD 562 CG17912-PD 1..343 1..343 1838 100 Plus
CG17912-PC 562 CG17912-PC 1..343 1..343 1838 100 Plus
CG17912-PB 562 CG17912-PB 1..343 1..343 1838 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 17:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17053-PA 386 GI17053-PA 1..386 1..357 979 71.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 17:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18783-PA 485 GL18783-PA 1..268 82..347 654 85.1 Plus
Dper\GL18782-PA 76 GL18782-PA 1..70 1..69 290 76.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 17:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14721-PA 566 GA14721-PA 1..349 1..347 1145 88.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 17:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17201-PA 357 GM17201-PA 1..357 1..357 1855 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 17:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24078-PA 563 GD24078-PA 1..343 1..343 1809 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 17:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17303-PA 597 GJ17303-PA 1..361 1..347 886 72 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 17:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18230-PA 527 GK18230-PA 1..313 1..279 804 64.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 17:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12761-PA 358 GE12761-PA 1..358 1..357 1467 95.8 Plus

GH18623.hyp Sequence

Translation from 126 to 1199

> GH18623.hyp
MGRKKKKASKPWCWYCNREFDDEKILVQHQKAKHFKCHICHKKLYTGPGL
SIHCMQVHKETVDKVPNSLPNRSNIEVEIFGMDGIPAEDLRDHERQKNGG
KSDSDDDEPVAKKKVEYAMSVPPPMMMPPNMMPPHMLGQYGMGMMQHMPP
LPPYPVPMMPHMMPPRPLFPAAMATTSAAAAAAAAHHHHAAAMAQQKPTF
PAYSNATISAPPTTNHAGGASSAPPSGPPDAQQHQQRPPAPPAASGTSAA
AVTTKIMHPQEDLSLEELRARQPKIQARLAAALASLANPQSRKSPSNNGG
PSTSIPTTPPPPSLAGISPTGSNSSSGMANSIVVSAAMSKAQEVSSYHSY
RNHSQYK*

GH18623.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-PA 357 CG17912-PA 1..357 1..357 1916 100 Plus
CG17912-PG 476 CG17912-PG 1..343 1..343 1838 100 Plus
CG17912-PD 562 CG17912-PD 1..343 1..343 1838 100 Plus
CG17912-PC 562 CG17912-PC 1..343 1..343 1838 100 Plus
CG17912-PB 562 CG17912-PB 1..343 1..343 1838 100 Plus