Clone GH19095 Report

Search the DGRC for GH19095

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:190
Well:95
Vector:pOT2
Associated Gene/TranscriptArr1-RA
Protein status:GH19095.pep: gold
Preliminary Size:2701
Sequenced Size:2876

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5711 2001-09-19 Blastp of sequenced clone
CG5711 2003-01-01 Sim4 clustering to Release 3
Arr1 2008-04-29 Release 5.5 accounting
CG13124 2008-08-15 Release 5.9 accounting
Arr1 2008-08-15 Release 5.9 accounting
CG13124 2008-12-18 5.12 accounting
Arr1 2008-12-18 5.12 accounting

Clone Sequence Records

GH19095.complete Sequence

2876 bp (2876 high quality bases) assembled on 2001-09-19

GenBank Submission: AY061824

> GH19095.complete
CTTGGGAGGCCTGTAGATATCCATGGCTGGTTTGCCCCTCATCTGTCCCG
TCTGATTGCCAGGTACGTTGAAAGCCAGACTTCGCCGTTTGTTGATATTC
TGTTGATTTGAGGTGCGCACAAAGCTGCGTTCGCGGGAGATAACGCCGGG
CTGAAATTCCGGTGATTTGCGCACCTTCCGCGTATCATTCTGTTGGCCAT
TCATGCTGGCCTGGGCCAGTAGTTCCACCTTTTCGGCCATCCTGCGATTT
TTGCGCGAGTACTGCTTCTGCTCTATTTGGGTAAAACCTAATTGAAGATG
AAAGCCTAATCTTTGGTAGATTATCCTCCGGTTAATCGATTCACAACTGG
GATTCCGTCGAATAAACGTCTAAATGTGTGGCTTCAGTATTTGAGTAAAT
TTGTACATATCACAATAGTTGGTTTCCTTTCCTCCTTTATCGAGTTGAGT
TCTCTTCTTAATACGATGTTGAGGGATATCTTCCCCTTTTGCAGATTCAG
ATTGCCGGGTCTTTTAGTGCAAAAATATTTCCTTCAAATTGTTTCGTTGT
TGCTGCTGCTGTTGCTGCTTGAGCTTTTGTTTATCTCTGTCTATAGTGTA
TATATAGATGGGTTTGTTTGTGCGTTGTTGCTATTCGTCGATTCGATTGT
TGCTTGGTGCCGCAGCTTAGTTGTTCGTATAAAGATATTTATCTACTTCG
TAGATACGCTCTTTCGTGTCTCGTTTAATCATGCTTGGCATGCGCCAAGT
CAAGCCGTAAACAGTGTCAGAAATAATTAATATTTCGAAGCGTCCCTCCA
CGCCCAAATAGTCCGCATATGGGGTAATACACTAGATGGTTATGGATTGC
GGGCCTCTAGACACAGATACAGATGCAGGCAGATACAGCGGCAAATGCAA
AAAAAGGCACAGATACGCATACGCATACGCACTCACACAAACGCACTGTG
ATCACAATTGATTTTAGTGCCTATTGTTGTTGCTTTTGCTCGGATGACTG
GTGGCTGCGTTGGTATCGTCTATTTTTGGTTTGTCGCTTTGTGCTGCTTG
TTCTCGGCTCGTTGTCTGCTCGTCGTCAATTATTACCGATTCCGTTTTGG
TTTCTTAATTTTTGTTCGCGTTGTTGTGTTCGTTCGTTTTTCTTTTTATT
GTGATTTTTCTCTCATTTAATGCAGATCGCTCGCTATTTATGTATATAAT
ATAGTTATTGTTCGGATTACTCTCACACGTACACATACAAGCGGTCATTT
AGGTTTCCATGGGTTCGTTGCTGTCGATCGAGACACTATATCTGCGGGGT
ATATCTATTTATCGATGTACGCCGTATTATGTGAGCATGTATGTATATTC
GCACGTATGTATGTATATGGATGTGAGTAACGCTGCCGGCTGCTACACTG
GGCGCAGGCTTTAACTTAAAAATTAAATCATCGGCGCGAGGCAACGCGGC
GTATACCATCGAGAACGAGCGCGAAACGTTAAAGGCACATCCAAAGTTTA
AACTATTTCCGCAGAGATTTTGATAAACAGCTCCAAAATGGTGGTCAATT
TCAAGGTGTTCAAGAAGTGTTCCCCGAACAACATGATCACGCTCTACATG
AACAGGCGTGATTTTGTAGATTCCGTGACTCAGGTGGAACCCATTGATGG
AATCATTGTGCTGGACGATGAGTACGTGCGCCAGAACCGCAAGATCTTCG
TGCAGTTGGTCTGCAATTTCCGATATGGGCGCGAGGACGACGAGATGATC
GGTCTGCGGTTCCAGAAGGAACTGACCCTGGTCTCGCAGCAGGTGTGCCC
ACCCCAGAAGCAGGACATCCAGTTGACCAAGATGCAGGAGCGTCTGCTGA
AGAAGCTTGGCTCCAATGCCTATCCCTTCGTGATGCAGATGCCACCAAGC
TCGCCGGCCTCGGTGGTTCTCCAGCAGAAGGCCAGTGACGAGAGCCAGCC
CTGCGGAGTCCAGTACTTCGTAAAGATCTTTACCGGAGACAGCGACTGCG
ATCGATCGCATCGCAGGAGCACCATTAACCTGGGCATCCGCAAGGTGCAG
TACGCACCGACCAAGCAGGGCATCCAGCCCTGCACCGTCGTTCGCAAGGA
CTTCCTTCTGTCGCCCGGAGAGCTCGAACTGGAGGTCACCCTCGACAAGC
AGCTGTACCATCACGGCGAGAAGATCTCGGTGAACATCTGCGTGCGCAAC
AACTCCAACAAGGTGGTGAAGAAGATCAAGGCCATGGTGCAGCAGGGCGT
CGATGTGGTCCTGTTCCAGAACGGTCAGTTCCGCAACACGATCGCCTTCA
TGGAGACGAGCGAGGGATGTCCCCTGAACCCGGGATCCAGCCTGCAGAAG
GTCATGTATCTGGTGCCCACCCTGGTGGCCAATTGCGACCGCGCAGGCAT
CGCCGTTGAGGGTGATATCAAGCGCAAAGACACAGCTCTGGCCTCGACCA
CACTTATTGCCAGTCAGGATGCGAGGGATGCCTTTGGCATAATTGTTTCA
TATGCTGTGAAGGTCAAGCTTTTCTTGGGAGCCCTGGGCGGCGAGCTCTG
CGCTGAGCTACCATTTATTCTGATGCACCCGAAGCCAAGTCGCAAGGCCC
AACTGGAAGCCGAGGGCTCCATTGAGGCCTAAACTGAAAGGGCTACCTCA
ACCAACGAAAAAAATGGCGTATTTCTACAAGTCAAACCGATTTTTGTAGA
TCCTAAAAAATGCTGATGTTGCTGAAATGTTCTGAACTGCAGTCGTCGTA
CTTTTCCTATATAGCAAATCCAATATCCATATATTGTATGTGTGTATGTG
TATTATATTTATAACTCAACTAACAATTAAATATGAACAGAGTTTATGTA
TGTAAAAAAAAAAAAAAAAAAAAAAA

GH19095.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13124-RH 3101 CG13124-RH 33..1468 1440..2 7125 99.7 Minus
Arr1-RA 1507 Arr1-RA 87..1500 1441..2854 7070 100 Plus
Arr1.a 1437 Arr1.a 26..1040 1441..2455 5075 100 Plus
Arr1.a 1437 Arr1.a 1040..1430 2464..2854 1955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18077575..18078383 1646..2454 4045 100 Plus
chr2L 23010047 chr2L 9905974..9906471 511..1008 2490 100 Plus
chr2L 23010047 chr2L 9904948..9905360 100..512 2065 100 Plus
chr2L 23010047 chr2L 18078805..18079075 2583..2853 1355 100 Plus
chr2L 23010047 chr2L 9906531..9906770 1008..1247 1200 100 Plus
chr2L 23010047 chr2L 18076951..18077156 1441..1646 1030 100 Plus
chr2L 23010047 chr2L 9907348..9907540 1248..1440 950 99.5 Plus
chr2L 23010047 chr2L 18078617..18078746 2455..2584 650 100 Plus
chr2L 23010047 chr2L 9904790..9904889 3..102 500 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
Arr1-RB 1095 CG5711-PB 1..1095 1538..2632 5475 100 Plus
Arr1-RA 1095 CG5711-PA 1..1095 1538..2632 5475 100 Plus
Arr1-RC 1053 CG5711-PC 68..1053 1647..2632 4930 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:58:52 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13124-RH 3084 CG13124-RH 17..1452 1440..2 7115 99.8 Minus
CG13124-RB 3095 CG13124-RB 17..1463 1440..2 7080 99.4 Minus
Arr1-RB 2327 CG5711-RB 23..1435 1441..2853 7065 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
Arr1-PB 364 CG5711-PB 1..364 1538..2629 1781 100 Plus
Arr1-PA 364 CG5711-PA 1..364 1538..2629 1781 100 Plus
Arr1-PC 350 CG5711-PC 21..350 1640..2629 1591 99.4 Plus
krz-PB 470 CG1487-PB 48..396 1553..2596 882 50.3 Plus
krz-PA 470 CG1487-PA 48..396 1553..2596 882 50.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18078915..18079723 1646..2454 4045 100 Plus
2L 23513712 2L 9907051..9907548 511..1008 2490 100 Plus
2L 23513712 2L 9906033..9906445 100..512 2065 100 Plus
2L 23513712 2L 18080145..18080416 2583..2854 1360 100 Plus
2L 23513712 2L 9907608..9907847 1008..1247 1200 100 Plus
2L 23513712 2L 18078291..18078496 1441..1646 1030 100 Plus
2L 23513712 2L 9908425..9908617 1248..1440 965 100 Plus
2L 23513712 2L 18079957..18080086 2455..2584 650 100 Plus
2L 23513712 2L 9905875..9905974 3..102 500 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18078915..18079723 1646..2454 4045 100 Plus
2L 23513712 2L 9907051..9907548 511..1008 2490 100 Plus
2L 23513712 2L 9906033..9906445 100..512 2065 100 Plus
2L 23513712 2L 18080145..18080416 2583..2854 1360 100 Plus
2L 23513712 2L 9907608..9907847 1008..1247 1200 100 Plus
2L 23513712 2L 18078291..18078496 1441..1646 1030 100 Plus
2L 23513712 2L 9908425..9908617 1248..1440 965 100 Plus
2L 23513712 2L 18079957..18080086 2455..2584 650 100 Plus
2L 23513712 2L 9905875..9905974 3..102 500 100 Plus
Blast to na_te.dros performed 2014-11-27 08:52:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6714..6860 690..546 188 64.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2303..2432 669..539 164 63.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6709..6845 681..546 159 61.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6726..6841 654..529 147 63.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6710..6820 648..539 146 62.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2626..2676 581..528 145 79.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2401 631..542 139 67.7 Minus
roo 9092 roo DM_ROO 9092bp 1062..1153 632..544 127 64.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1497..1579 621..540 123 65.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2697..2816 652..539 116 60 Minus

GH19095.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:11:54 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18078807..18079075 2585..2853 100   Plus
chr2L 18078617..18078746 2455..2584 100 -> Plus
chr2L 18077576..18078383 1647..2454 100 -> Plus
chr2L 18076951..18077156 1441..1646 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:48:48 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 1..1095 1538..2632 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:06:32 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 1..1095 1538..2632 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:13:57 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 1..1095 1538..2632 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:37:20 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 1..1095 1538..2632 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:11:54 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 1..1095 1538..2632 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:56:19 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 26..1438 1441..2853 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:06:32 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
CG13124-RH 33..1468 1..1440 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:13:57 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
CG13124-RH 17..1452 1..1440 99   Minus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:37:20 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 26..1438 1441..2853 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:11:54 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
CG13124-RH 17..1452 1..1440 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:11:54 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18080147..18080415 2585..2853 100   Plus
2L 18079957..18080086 2455..2584 100 -> Plus
2L 18078916..18079723 1647..2454 100 -> Plus
2L 18078291..18078496 1441..1646 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:13:57 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18080147..18080415 2585..2853 100   Plus
arm_2L 18079957..18080086 2455..2584 100 -> Plus
arm_2L 18078916..18079723 1647..2454 100 -> Plus
arm_2L 18078291..18078496 1441..1646 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:14:28 Download gff for GH19095.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18080147..18080415 2585..2853 100   Plus
2L 18079957..18080086 2455..2584 100 -> Plus
2L 18078916..18079723 1647..2454 100 -> Plus
2L 18078291..18078496 1441..1646 100 -> Plus

GH19095.pep Sequence

Translation from 1537 to 2631

> GH19095.pep
MVVNFKVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQN
RKIFVQLVCNFRYGREDDEMIGLRFQKELTLVSQQVCPPQKQDIQLTKMQ
ERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASDESQPCGVQYFVKIFTG
DSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELEV
TLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRN
TIAFMETSEGCPLNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTA
LASTTLIASQDARDAFGIIVSYAVKVKLFLGALGGELCAELPFILMHPKP
SRKAQLEAEGSIEA*

GH19095.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14811-PA 364 GF14811-PA 1..364 1..364 1924 98.6 Plus
Dana\GF17501-PA 485 GF17501-PA 59..404 6..350 951 50.4 Plus
Dana\GF10152-PA 401 GF10152-PA 1..350 1..350 912 45.7 Plus
Dana\GF23483-PA 164 GF23483-PA 1..164 116..306 416 51.3 Plus
Dana\GF19559-PA 761 GF19559-PA 56..219 6..168 279 33.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21103-PA 364 GG21103-PA 1..364 1..364 1937 99.7 Plus
Dere\GG11843-PA 468 GG11843-PA 45..395 6..355 959 50.3 Plus
Dere\GG15065-PA 401 GG15065-PA 1..350 1..350 921 46.6 Plus
Dere\GG18921-PA 819 GG18921-PA 113..276 6..168 276 33.9 Plus
Dere\GG18921-PA 819 GG18921-PA 424..586 181..348 174 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11636-PA 364 GH11636-PA 1..364 1..364 1885 97 Plus
Dgri\GH17469-PA 494 GH17469-PA 70..420 6..355 965 49.7 Plus
Dgri\GH16146-PA 401 GH16146-PA 1..350 1..350 910 45.7 Plus
Dgri\GH22560-PA 149 GH22560-PA 1..140 1..141 410 48.9 Plus
Dgri\GH23290-PA 160 GH23290-PA 3..110 245..351 275 45.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Arr1-PB 364 CG5711-PB 1..364 1..364 1866 100 Plus
Arr1-PA 364 CG5711-PA 1..364 1..364 1866 100 Plus
Arr1-PC 350 CG5711-PC 21..350 35..364 1676 99.4 Plus
krz-PB 470 CG1487-PB 48..396 6..353 931 50.6 Plus
krz-PA 470 CG1487-PA 48..396 6..353 931 50.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17937-PA 364 GI17937-PA 1..364 1..364 1888 97.3 Plus
Dmoj\GI22795-PA 498 GI22795-PA 74..424 6..355 968 50.3 Plus
Dmoj\GI12414-PA 401 GI12414-PA 1..350 1..350 920 46.6 Plus
Dmoj\GI15392-PA 824 GI15392-PA 108..271 6..168 287 35.8 Plus
Dmoj\GI15392-PA 824 GI15392-PA 425..659 158..347 244 30 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14653-PA 363 GL14653-PA 1..363 1..364 1867 97.8 Plus
Dper\GL10292-PA 401 GL10292-PA 1..350 1..350 926 46.9 Plus
Dper\GL24101-PA 479 GL24101-PA 67..396 6..347 866 47.4 Plus
Dper\GL14887-PA 673 GL14887-PA 135..298 6..168 274 33.9 Plus
Dper\GL14887-PA 673 GL14887-PA 449..582 181..313 182 34.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:31:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19076-PA 363 GA19076-PA 1..363 1..364 1867 97.8 Plus
Dpse\GA13309-PA 492 GA13309-PA 67..409 6..347 932 49.7 Plus
Dpse\GA19261-PA 401 GA19261-PA 1..350 1..350 926 46.9 Plus
Dpse\GA17070-PA 968 GA17070-PA 185..348 6..168 272 33.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17260-PA 364 GM17260-PA 1..364 1..364 1937 99.7 Plus
Dsec\GM16407-PA 471 GM16407-PA 48..396 6..353 959 50.6 Plus
Dsec\GM24922-PA 401 GM24922-PA 1..350 1..350 912 46.3 Plus
Dsec\GM11315-PA 581 GM11315-PA 99..262 6..168 275 33.9 Plus
Dsec\GM11315-PA 581 GM11315-PA 405..477 181..253 171 43.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24126-PA 364 GD24126-PA 1..364 1..364 1937 99.7 Plus
Dsim\GD12969-PA 401 GD12969-PA 1..350 1..350 921 46.6 Plus
Dsim\GD16195-PA 341 GD16195-PA 4..266 93..353 704 50.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17709-PA 364 GJ17709-PA 1..364 1..364 1850 96.7 Plus
Dvir\GJ22798-PA 489 GJ22798-PA 65..415 6..355 972 50.6 Plus
Dvir\GJ12307-PA 401 GJ12307-PA 1..350 1..350 904 45.7 Plus
Dvir\GJ14679-PA 92 GJ14679-PA 1..92 273..364 472 98.9 Plus
Dvir\GJ14789-PA 830 GJ14789-PA 137..300 6..168 281 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18171-PA 364 GK18171-PA 1..364 1..364 1871 97.5 Plus
Dwil\GK10933-PA 495 GK10933-PA 67..417 6..355 965 50.3 Plus
Dwil\GK17474-PA 401 GK17474-PA 1..350 1..350 913 46.3 Plus
Dwil\GK19772-PA 954 GK19772-PA 209..372 6..168 283 35.2 Plus
Dwil\GK19772-PA 954 GK19772-PA 524..657 181..313 183 34.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Arr1-PA 364 GE12809-PA 1..364 1..364 1932 99.5 Plus
Dyak\GE23289-PA 471 GE23289-PA 48..398 6..355 959 50.3 Plus
Dyak\GE21289-PA 401 GE21289-PA 1..350 1..350 921 46.6 Plus
Dyak\GE15393-PA 809 GE15393-PA 110..273 6..168 277 33.9 Plus
Dyak\GE15393-PA 809 GE15393-PA 413..575 181..348 174 30.1 Plus

GH19095.hyp Sequence

Translation from 1537 to 2631

> GH19095.hyp
MVVNFKVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQN
RKIFVQLVCNFRYGREDDEMIGLRFQKELTLVSQQVCPPQKQDIQLTKMQ
ERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASDESQPCGVQYFVKIFTG
DSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELEV
TLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRN
TIAFMETSEGCPLNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTA
LASTTLIASQDARDAFGIIVSYAVKVKLFLGALGGELCAELPFILMHPKP
SRKAQLEAEGSIEA*

GH19095.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
Arr1-PB 364 CG5711-PB 1..364 1..364 1866 100 Plus
Arr1-PA 364 CG5711-PA 1..364 1..364 1866 100 Plus
Arr1-PC 350 CG5711-PC 21..350 35..364 1676 99.4 Plus
krz-PB 470 CG1487-PB 48..396 6..353 931 50.6 Plus
krz-PA 470 CG1487-PA 48..396 6..353 931 50.6 Plus