Clone GH19318 Report

Search the DGRC for GH19318

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:193
Well:18
Vector:pOT2
Associated Gene/Transcriptkni-RA
Protein status:GH19318.pep: gold
Preliminary Size:1579
Sequenced Size:2104

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4717 2002-01-01 Sim4 clustering to Release 2
CG4717 2002-05-18 Blastp of sequenced clone
CG4717 2003-01-01 Sim4 clustering to Release 3
kni 2008-04-29 Release 5.5 accounting
kni 2008-08-15 Release 5.9 accounting
kni 2008-12-18 5.12 accounting

Clone Sequence Records

GH19318.complete Sequence

2104 bp assembled on 2007-04-18

GenBank Submission: AY118798

> GH19318.complete
AGTAGCCGAAGTGTCAGTTACACACATCGAGGATTCCCAAACCGCGTTGT
TTCGGCGATCAAAAACCATACATCACATCAAATCGTATCCAAAATTATAA
TCAAAGTGTTGAAAACCTGAATCACTCAGACTGATCGAAAAGTGCTTGCA
AACCGAAAACAAAACAAAAAAAAAAAAAATAACAGACACAAACTGCCAAA
GTGAGAAAACGTGCAGCAACGATCGCGAATCGCTGCAATTAAAAAGTCGT
CATAAACCTAGTGCCCATCCAACAAAAAAAAGCAAAAAGATGAACCAGAC
ATGCAAAGTGTGCGGTGAGCCGGCGGCGGGCTTCCATTTTGGCGCCTTCA
CCTGCGAGGGCTGCAAGTCCTTCTTTGGCCGCTCTTACAACAACATCAGC
ACCATCAGCGAGTGCAAGAACGAGGGCAAGTGCATCATCGACAAGAAGAA
CCGCACCACCTGCAAGGCGTGCCGCTTGAGGAAGTGCTACAACGTGGGCA
TGTCGAAGGGGGGATCCCGCTACGGACGTCGCTCCAACTGGTTCAAGATC
CATTGTCTGCTGCAGGAGCACGAACAGGCCGCCGCAGCGGCGGGCAAGGC
GCCTCCATTAGCGGGTGGCGTATCGGTGGGTGGTGCCCCGTCGGCCTCTT
CCCCGGTGGGCTCGCCACACACTCCCGGATTTGGGGACATGGCCGCCCAT
TTGCACCACCATCATCAGCAGCAGCAGCAGCAGCAGGTGCCGCGTCATCC
ACATATGCCTCTGCTGGGCTATCCCAGCTATCTGTCCGACCCATCCGCCG
CCCTGCCCTTCTTCAGCATGATGGGCGGTGTACCGCACCAGTCGCCCTTC
CAGCTGCCCCCACACCTCCTCTTCCCAGGCTACCATGCAAGTGCTGCCGC
TGCAGCGGCTTCTGCTGCCGATGCCGCTTACCGGCAGGAGATGTACAAGC
ACCGCCAGAGCGTGGATTCCGTTGAGTCGCAGAACCGCTTTAGTCCCGCC
AGCCAGCCACCAGTGGTGCAGCCCACCTCCTCGGCCCGCCAGTCGCCCAT
CGATGTCTGCCTGGAGGAGGATGTTCACTCCGTGCACAGCCATCAGTCGT
CCGCAAGCCTCCTGCATCCCATTGCCATCCGAGCCACGCCAACCACTCCG
ACTAGCAGCAGCCCGCTGAGTTTTGCGGCCAAGATGCAGAGCTTGTCGCC
CGTTTCGGTTTGCTCCATTGGCGGCGAAACCACCAGCGTTGTACCAGTGC
ATCCTCCCACCGTTTCCGCTCAAGAAGGACCCATGGATCTGAGCATGAAG
ACCTCGCGGAGCTCCGTGCACAGCTTCAACGACAGCGGCTCCGAGGATCA
AGAAGTGGAGGTGGCTCCGCGCCGGAAGTTCTACCAACTGGAGGCCGAGT
GCCTGACCACCAGCAGCAGCAGTTCCTCCCACTCCGCCGCCCACTCACCG
AACACCACCACCGCCCATGCGGAAGTCAAGCGGCAGAAGCTAGGTGGTGC
AGAGGCCACCCACTTCGGTGGCTTCGCGGTGGCCCACAATGCGGCTAGTG
CCATGAGGGGAATATTCGTGTGTGTCTAAGTACACGGCGAAAAAACCAAG
TGGGAGGAGTCGCCCCAAAAACCCTCGTTGTTTATTTTTTGTTACTTAAA
GAAAATGTAAATTTATTCGTGTGCTCGCTCACACTTAGGGAAGTGGAAAG
AGATAGGGACAGACAGGTTTTGCTGGAAAGAGACAGCCTGACCAGGTAGT
TGCATTGCACTCGCACACATACACCTATATACCACCACACACACACTCAC
ACTCACCTATTGAGCTCGGATCCAAAAATTATTTTTTATGAAAACGTTAA
AATTGTAAATATATCTTTGAGCTTGTTTGCAATTGTATTTTAAAGTTAGC
CGGCGGAAGAGCCGTAGAAGTAGTAATCATTCCCACCCTCAAATGCTATT
GTACATACAAATTGTTAAGTCTAAGAATGATCTTTATTGTCTCTAAGTAT
TTTATTCTATTATAGTCCTAGTTATGGTATGTCTAAAGATTGGCATTTAG
TTTTATACAAAGAAAAATAAAAACTATTAAAAATTAAAAAAAAAAAAAAA
AAAA

GH19318.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
kni-RA 2215 kni-RA 131..2215 1..2085 10425 100 Plus
kni.a 1977 kni.a 181..1977 289..2085 8985 100 Plus
knrl-RA 3973 knrl-RA 1168..1329 409..570 510 87.6 Plus
knrl-RA 3973 knrl-RA 1048..1152 289..393 315 86.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20681342..20683061 2085..366 8600 100 Minus
chr3L 24539361 chr3L 20684087..20684375 289..1 1445 100 Minus
chr3L 24539361 chr3L 20588789..20588993 570..366 515 83.4 Minus
chr3L 24539361 chr3L 20683275..20683354 367..288 400 100 Minus
chr3L 24539361 chr3L 21805282..21805415 437..570 355 84.3 Plus
chr3L 24539361 chr3L 20591204..20591283 367..288 235 86.2 Minus
chr3L 24539361 chr3L 21803712..21803791 288..367 205 83.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
kni-RB 1305 CG4717-PB 15..1305 289..1579 6455 100 Plus
kni-RA 1290 CG4717-PA 1..1290 290..1579 6450 100 Plus
knrl-RB 1944 CG4761-PB 27..308 289..570 735 84 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:59:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
kni-RA 2100 CG4717-RA 16..2100 1..2085 10425 100 Plus
kni-RB 1911 CG4717-RB 115..1911 289..2085 8985 100 Plus
knrl-RB 2925 CG4761-RB 991..1272 289..570 735 84 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
kni-PA 429 CG4717-PA 1..429 290..1576 1519 100 Plus
kni-PB 434 CG4717-PB 6..434 290..1576 1519 100 Plus
knrl-PB 647 CG4761-PB 10..105 290..577 482 86.5 Plus
knrl-PA 647 CG4761-PA 10..105 290..577 482 86.5 Plus
eg-PA 373 CG7383-PA 1..95 290..574 453 82.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20692327..20694049 2088..366 8615 100 Minus
3L 28110227 3L 20695075..20695363 289..1 1445 100 Minus
3L 28110227 3L 20599778..20599982 570..366 515 83.4 Minus
3L 28110227 3L 20694263..20694342 367..288 400 100 Minus
3L 28110227 3L 21816347..21816480 437..570 355 84.3 Plus
3L 28110227 3L 20602193..20602272 367..288 235 86.2 Minus
3L 28110227 3L 21814777..21814856 288..367 205 83.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20685427..20687149 2088..366 8615 100 Minus
3L 28103327 3L 20688175..20688463 289..1 1445 100 Minus
3L 28103327 3L 20592878..20593039 570..409 510 87.6 Minus
3L 28103327 3L 20687363..20687442 367..288 400 100 Minus
3L 28103327 3L 21809447..21809580 437..570 355 84.3 Plus
3L 28103327 3L 20595293..20595372 367..288 235 86.2 Minus
3L 28103327 3L 21807877..21807956 288..367 205 83.7 Plus
Blast to na_te.dros performed 2014-11-27 12:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2443..2519 386..465 150 67.5 Plus
HMS-Beagle2 7220 HMS-Beagle2 Beagle2 7220bp 4500..4612 79..191 141 60.5 Plus
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 2477..2541 1888..1825 115 66.2 Minus

GH19318.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:56:06 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20684087..20684375 1..289 100   Minus
chr3L 20683275..20683352 290..367 100 <- Minus
chr3L 20681342..20683059 368..2085 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:49:04 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 1..1290 290..1579 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:18:52 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 1..1290 290..1579 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:57 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 1..1290 290..1579 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:15:17 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 1..1290 290..1579 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:56:06 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RB 9..1305 283..1579 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:34:34 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 1..2085 1..2085 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:18:51 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 1..2085 1..2085 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:57 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 16..2100 1..2085 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:15:17 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 1..2085 1..2085 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:56:06 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 16..2100 1..2085 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:56:06 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20695075..20695363 1..289 100   Minus
3L 20694263..20694340 290..367 100 <- Minus
3L 20692330..20694047 368..2085 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:57 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20688175..20688463 1..289 100   Minus
arm_3L 20687363..20687440 290..367 100 <- Minus
arm_3L 20685430..20687147 368..2085 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:07:54 Download gff for GH19318.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20688175..20688463 1..289 100   Minus
3L 20687363..20687440 290..367 100 <- Minus
3L 20685430..20687147 368..2085 100 <- Minus

GH19318.pep Sequence

Translation from 289 to 1578

> GH19318.pep
MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCII
DKKNRTTCKACRLRKCYNVGMSKGGSRYGRRSNWFKIHCLLQEHEQAAAA
AGKAPPLAGGVSVGGAPSASSPVGSPHTPGFGDMAAHLHHHHQQQQQQQV
PRHPHMPLLGYPSYLSDPSAALPFFSMMGGVPHQSPFQLPPHLLFPGYHA
SAAAAAASAADAAYRQEMYKHRQSVDSVESQNRFSPASQPPVVQPTSSAR
QSPIDVCLEEDVHSVHSHQSSASLLHPIAIRATPTTPTSSSPLSFAAKMQ
SLSPVSVCSIGGETTSVVPVHPPTVSAQEGPMDLSMKTSRSSVHSFNDSG
SEDQEVEVAPRRKFYQLEAECLTTSSSSSSHSAAHSPNTTTAHAEVKRQK
LGGAEATHFGGFAVAHNAASAMRGIFVCV*

GH19318.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 01:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24121-PA 446 GF24121-PA 6..446 1..429 1524 78.5 Plus
Dana\GF24122-PA 674 GF24122-PA 10..100 1..91 488 87.9 Plus
Dana\GF25170-PA 376 GF25170-PA 1..95 1..95 470 82.1 Plus
Dana\GF12134-PA 448 GF12134-PA 51..127 5..82 227 44.9 Plus
Dana\GF24303-PA 892 GF24303-PA 406..480 5..80 223 47.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 01:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13292-PA 433 GG13292-PA 6..433 1..429 1895 96.7 Plus
Dere\GG13294-PA 643 GG13294-PA 10..100 1..91 487 87.9 Plus
Dere\GG16225-PA 376 GG16225-PA 1..95 1..95 472 82.1 Plus
Dere\GG25225-PA 702 GG25225-PA 266..342 5..82 230 44.9 Plus
Dere\GG16168-PA 863 GG16168-PA 358..432 5..80 226 47.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 01:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16981-PA 509 GH16981-PA 6..509 1..429 1075 59.8 Plus
Dgri\GH16982-PA 682 GH16982-PA 10..100 1..91 488 87.9 Plus
Dgri\GH16373-PA 383 GH16373-PA 1..95 1..95 475 82.1 Plus
Dgri\GH20117-PA 487 GH20117-PA 51..127 5..82 229 44.9 Plus
Dgri\GH14219-PA 445 GH14219-PA 34..191 5..183 225 31.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
kni-PB 434 CG4717-PB 6..434 1..429 2276 100 Plus
kni-PA 429 CG4717-PA 1..429 1..429 2276 100 Plus
knrl-PB 647 CG4761-PB 10..128 1..116 503 78.2 Plus
knrl-PA 647 CG4761-PA 10..128 1..116 503 78.2 Plus
eg-PA 373 CG7383-PA 1..118 1..120 470 71.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 01:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11896-PA 469 GI11896-PA 1..469 1..429 1119 60.7 Plus
Dmoj\GI11566-PA 377 GI11566-PA 1..104 1..104 487 77.9 Plus
Dmoj\GI11900-PA 671 GI11900-PA 10..100 1..91 487 87.9 Plus
Dmoj\GI20211-PA 487 GI20211-PA 51..127 5..82 229 44.9 Plus
Dmoj\GI13134-PA 569 GI13134-PA 79..153 5..80 223 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 01:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12762-PA 455 GL12762-PA 1..455 1..429 1274 67.7 Plus
Dper\GL24862-PA 390 GL24862-PA 1..101 1..101 480 79.2 Plus
Dper\GL12764-PA 707 GL12764-PA 30..103 1..91 363 71.4 Plus
Dper\GL10487-PA 487 GL10487-PA 51..127 5..82 229 44.9 Plus
Dper\GL13521-PA 454 GL13521-PA 34..158 5..123 210 33.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 01:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18381-PA 493 GA18381-PA 6..493 1..429 1279 65.6 Plus
Dpse\GA18413-PA 705 GA18413-PA 10..100 1..91 481 86.8 Plus
Dpse\GA20312-PA 390 GA20312-PA 1..101 1..101 479 79.2 Plus
Dpse\GA17350-PA 487 GA17350-PA 51..127 5..82 229 44.9 Plus
Dpse\GA14768-PA 897 GA14768-PA 407..481 5..80 224 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 01:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\kni-PA 431 GM22197-PA 5..431 1..429 1890 96.7 Plus
Dsec\GM22199-PA 643 GM22199-PA 10..100 1..91 488 87.9 Plus
Dsec\GM22351-PA 986 GM22351-PA 493..567 5..80 225 47.4 Plus
Dsec\GM24962-PA 495 GM24962-PA 121..199 1..80 190 44.4 Plus
Dsec\GM12759-PA 703 GM12759-PA 140..208 4..73 189 44.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 01:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\kni-PA 378 GD12172-PA 1..378 1..429 1731 86.2 Plus
Dsim\GD15001-PA 388 GD15001-PA 9..100 1..92 466 83.7 Plus
Dsim\GD26001-PA 627 GD26001-PA 436..512 5..82 230 44.9 Plus
Dsim\GD12358-PA 433 GD12358-PA 245..347 5..108 220 40.4 Plus
Dsim\GD21550-PA 452 GD21550-PA 34..197 5..158 219 32.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 01:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\kni-PA 486 GJ13773-PA 6..486 1..429 1109 58.9 Plus
Dvir\GJ13774-PA 654 GJ13774-PA 10..131 1..116 491 71.1 Plus
Dvir\GJ11245-PA 367 GJ11245-PA 1..326 1..306 482 37.1 Plus
Dvir\GJ20161-PA 487 GJ20161-PA 51..127 5..82 229 44.9 Plus
Dvir\tll-PA 450 GJ24246-PA 34..158 5..123 210 33.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 01:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10545-PA 458 GK10545-PA 6..458 1..429 1201 64.8 Plus
Dwil\GK10566-PA 666 GK10566-PA 10..100 1..91 486 87.9 Plus
Dwil\GK17344-PA 377 GK17344-PA 1..93 1..93 471 83.9 Plus
Dwil\GK18019-PA 524 GK18019-PA 53..129 5..82 229 44.9 Plus
Dwil\GK16819-PA 1021 GK16819-PA 473..547 5..80 224 47.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 01:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22389-PA 433 GE22389-PA 6..433 1..429 1901 97 Plus
Dyak\GE22392-PA 657 GE22392-PA 10..100 1..91 477 87.9 Plus
Dyak\GE23274-PA 461 GE23274-PA 86..180 1..95 469 82.1 Plus
Dyak\GE19793-PA 449 GE19793-PA 74..168 1..95 469 82.1 Plus
Dyak\GE21721-PA 487 GE21721-PA 51..127 5..82 229 44.9 Plus

GH19318.hyp Sequence

Translation from 289 to 1578

> GH19318.hyp
MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCII
DKKNRTTCKACRLRKCYNVGMSKGGSRYGRRSNWFKIHCLLQEHEQAAAA
AGKAPPLAGGVSVGGAPSASSPVGSPHTPGFGDMAAHLHHHHQQQQQQQV
PRHPHMPLLGYPSYLSDPSAALPFFSMMGGVPHQSPFQLPPHLLFPGYHA
SAAAAAASAADAAYRQEMYKHRQSVDSVESQNRFSPASQPPVVQPTSSAR
QSPIDVCLEEDVHSVHSHQSSASLLHPIAIRATPTTPTSSSPLSFAAKMQ
SLSPVSVCSIGGETTSVVPVHPPTVSAQEGPMDLSMKTSRSSVHSFNDSG
SEDQEVEVAPRRKFYQLEAECLTTSSSSSSHSAAHSPNTTTAHAEVKRQK
LGGAEATHFGGFAVAHNAASAMRGIFVCV*

GH19318.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
kni-PB 434 CG4717-PB 6..434 1..429 2276 100 Plus
kni-PA 429 CG4717-PA 1..429 1..429 2276 100 Plus
knrl-PB 647 CG4761-PB 10..128 1..116 503 78.2 Plus
knrl-PA 647 CG4761-PA 10..128 1..116 503 78.2 Plus
eg-PA 373 CG7383-PA 1..118 1..120 470 71.7 Plus