Clone GH19566 Report

Search the DGRC for GH19566

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:195
Well:66
Vector:pOT2
Associated Gene/TranscriptnSyb-RH
Protein status:GH19566.pep: gold
Preliminary Size:1405
Sequenced Size:1285

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
n-syb-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

GH19566.complete Sequence

1285 bp assembled on 2009-08-13

GenBank Submission: BT099571.1

> GH19566.complete
AAAACGTCCAGTTCCAGCGCTGAGCCAGAAAATTCCTGCGAAAGGCTGTC
GTGGCAAGTGTTACCCGCACACATACACATCATCCAGATCCAGCCAATCC
CCCCGTGGAGTGGAGTGAATTTTCATTGACGACGGGGCGAAAAAGCTCTG
GCGGAAGAGCGACAGAGAGAGAGAGAAACAGAGAGAGAGAGAGAGAAGCG
GCACTGAGAGCGCAACCCTCTAGAACAAAAACAACGAAACAGAGTTCAGC
TGCACCACCACCCACTACCTACACCACCAACGCCACCACCGCCCACTGAC
CATCCCACATCCCGACCTGCGCCAGTGGAAGACAGTGAAAGAGGCCAAGT
GCATCGTGCATAGAGTACCTTCATCCTAATCATCGACAGCCGAATTCGCT
GAGGCCACCAGAGCACCACCAGCCAAACCACAGAAGCAACCACACAGCCA
CCAGAGCCATAGCCCAGAAGCCGAGTTAAAGGTCAAAGTTTTTGGGGGTC
TGAGATGGGAAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAG
CTGGCGATGCACCACCCAATGCCGGAGCCCCGGCCGGAGAGGGCGGCGAT
GGCGAGATTGTGGGCGGACCACACAATCCGCAGCAGATCGCGGCACAGAA
GCGTCTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGC
GCACGAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTG
GACGACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCA
GGCGGGCAAGCTCAAGAGGAAATTCTGGCTTCAGAACTTAAAGATGATGA
TCATCATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAA
GACGAAGAATAATCACACAGAAAGCTTCAGCTTTGTACAATTTTATTAAC
CATAAGCAAATCAATTTACCCAATATAACACTTTGTGTGTGAGATAAACT
TGGACTCATAGGCGGGGAGCAGCCGCCACAGTACCAGTATCCCCCACAGT
ACATGCAGCCACCGCCGCCGCCACCGCAGCAGCCAGCCGGAGGACAGTCA
TCGCTGGTGGATGCGGCAGGAGCAGGAGACGGAGCAGGAGCAGGAGGATC
GGCAGGAGCTGGCGATCACGGCGGCGTGTAAGCAATCCCGCTGCCAGGAC
GAAAGTTTCTCGATTAGTGTGCTCCTTCAGCGGGCGAAAACAAAGCAGAG
AAGACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH19566.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
n-syb.h 3229 n-syb.h 140..1403 1..1264 6305 99.9 Plus
n-syb-RH 1556 n-syb-RH 154..1417 1..1264 6305 99.9 Plus
n-syb.j 3130 n-syb.j 49..1304 9..1264 6265 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1636414..1636868 460..9 2180 99.1 Minus
chr3L 24539361 chr3L 1631789..1632046 1255..992 1180 97.3 Minus
chr3L 24539361 chr3L 1635128..1635280 686..534 765 100 Minus
chr3L 24539361 chr3L 1634897..1635057 843..683 760 98.1 Minus
chr3L 24539361 chr3L 1633297..1633407 999..889 510 97.3 Minus
chr3L 24539361 chr3L 1635532..1635605 534..461 370 100 Minus
chr2R 21145070 chr2R 6138435..6138646 866..655 310 76.4 Minus
chr3L 24539361 chr3L 1634782..1634835 895..842 270 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
nSyb-RI 408 CG17248-PI 1..408 505..912 2040 100 Plus
nSyb-RH 408 CG17248-PH 1..408 505..912 2040 100 Plus
nSyb-RG 579 CG17248-PG 1..396 505..900 1965 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:59:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
nSyb-RH 1277 CG17248-RH 23..1277 1..1255 6275 100 Plus
nSyb-RI 3570 CG17248-RI 23..1016 1..994 4970 100 Plus
nSyb-RE 1460 CG17248-RE 23..922 1..900 4485 99.9 Plus
nSyb-RI 3570 CG17248-RI 1464..1725 994..1255 1310 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
nSyb-PI 135 CG17248-PI 1..135 505..909 415 100 Plus
nSyb-PH 135 CG17248-PH 1..135 505..909 415 100 Plus
nSyb-PG 192 CG17248-PG 1..113 505..843 401 100 Plus
nSyb-PE 192 CG17248-PE 1..113 505..843 401 100 Plus
nSyb-PK 125 CG17248-PK 30..104 619..843 376 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1636818..1637269 460..9 2260 100 Minus
3L 28110227 3L 1632184..1632456 1264..992 1350 99.6 Minus
3L 28110227 3L 1635301..1635461 843..683 805 100 Minus
3L 28110227 3L 1635532..1635684 686..534 765 100 Minus
3L 28110227 3L 1633703..1633813 999..889 510 97.3 Minus
3L 28110227 3L 1635936..1636009 534..461 370 100 Minus
2R 25286936 2R 10250908..10251119 866..655 295 75.9 Minus
3L 28110227 3L 1635186..1635239 895..842 270 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1636818..1637269 460..9 2260 100 Minus
3L 28103327 3L 1632184..1632456 1264..992 1350 99.6 Minus
3L 28103327 3L 1635301..1635461 843..683 805 100 Minus
3L 28103327 3L 1635532..1635684 686..534 765 100 Minus
3L 28103327 3L 1633703..1633813 999..889 510 97.2 Minus
3L 28103327 3L 1635936..1636009 534..461 370 100 Minus
2R 25260384 2R 10252157..10252318 816..655 285 78.3 Minus
3L 28103327 3L 1635186..1635239 895..842 270 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:40:04 has no hits.

GH19566.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:11:36 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1635533..1635605 461..533 100 <- Minus
chr3L 1635130..1635280 534..684 100 <- Minus
chr3L 1634897..1635055 685..843 98 <- Minus
chr3L 1634782..1634833 844..895 100 <- Minus
chr3L 1633303..1633400 896..993 100 <- Minus
chr3L 1631789..1632044 994..1255 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:57 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
n-syb-RD 1..666 505..1181 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:24 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
n-syb-RG 397..579 999..1181 100   Plus
n-syb-RG 1..396 505..900 99 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:18:29 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
n-syb-RH 1..408 505..912 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:11:36 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
nSyb-RH 1..408 505..912 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-13 10:02:32 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
n-syb-RD 1..1242 5..1255 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:24 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
n-syb-RH 38..1292 1..1255 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:18:29 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
n-syb-RH 23..1277 1..1255 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:11:36 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
nSyb-RH 23..1277 1..1255 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:11:36 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1636818..1637269 9..460 100   Minus
3L 1635937..1636009 461..533 100 <- Minus
3L 1635534..1635684 534..684 100 <- Minus
3L 1635301..1635459 685..843 100 <- Minus
3L 1635186..1635237 844..895 100 <- Minus
3L 1633709..1633806 896..993 100 <- Minus
3L 1632193..1632454 994..1255 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:18:29 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1636818..1637269 9..460 100   Minus
arm_3L 1635937..1636009 461..533 100 <- Minus
arm_3L 1635534..1635684 534..684 100 <- Minus
arm_3L 1635301..1635459 685..843 100 <- Minus
arm_3L 1635186..1635237 844..895 100 <- Minus
arm_3L 1633709..1633806 896..993 100 <- Minus
arm_3L 1632193..1632454 994..1255 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:50:03 Download gff for GH19566.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1636818..1637269 9..460 100   Minus
3L 1635937..1636009 461..533 100 <- Minus
3L 1635534..1635684 534..684 100 <- Minus
3L 1635301..1635459 685..843 100 <- Minus
3L 1635186..1635237 844..895 100 <- Minus
3L 1633709..1633806 896..993 100 <- Minus
3L 1632193..1632454 994..1255 100 <- Minus

GH19566.pep Sequence

Translation from 504 to 911

> GH19566.pep
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE*

GH19566.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24019-PA 190 GF24019-PA 1..132 1..132 658 98.5 Plus
Dana\GF12131-PA 132 GF12131-PA 35..126 38..129 330 72.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14581-PA 217 GG14581-PA 1..132 1..132 661 98.5 Plus
Dere\GG25222-PA 153 GG25222-PA 18..127 15..129 324 62.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15523-PA 190 GH15523-PA 1..132 1..132 613 92.4 Plus
Dgri\GH20114-PA 126 GH20114-PA 6..110 23..119 304 65.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
nSyb-PI 135 CG17248-PI 1..135 1..135 682 100 Plus
nSyb-PH 135 CG17248-PH 1..135 1..135 682 100 Plus
nSyb-PG 192 CG17248-PG 1..132 1..132 661 99.2 Plus
nSyb-PE 192 CG17248-PE 1..132 1..132 661 99.2 Plus
nSyb-PK 125 CG17248-PK 2..121 11..130 603 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16800-PA 192 GI16800-PA 1..132 1..132 554 93.2 Plus
Dmoj\GI20208-PA 152 GI20208-PA 18..117 15..119 324 65.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20732-PA 189 GL20732-PA 1..131 1..132 516 91.7 Plus
Dper\GL10482-PA 131 GL10482-PA 44..125 48..129 311 76.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28300-PA 189 GA28300-PA 1..131 1..132 517 91.7 Plus
Dpse\GA11480-PA 131 GA11480-PA 44..125 48..129 311 76.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14195-PA 221 GM14195-PA 1..132 1..132 666 99.2 Plus
Dsec\GM20541-PA 152 GM20541-PA 18..126 15..129 333 62.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17610-PA 213 GD17610-PA 1..132 1..132 666 99.2 Plus
Dsim\GD25998-PA 152 GD25998-PA 18..126 15..129 333 62.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12544-PA 189 GJ12544-PA 1..132 1..132 551 91.7 Plus
Dvir\GJ20156-PA 152 GJ20156-PA 6..117 23..119 310 61.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23666-PA 190 GK23666-PA 1..132 1..132 653 97 Plus
Dwil\GK18016-PA 132 GK18016-PA 43..126 46..129 318 77.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20941-PA 223 GE20941-PA 1..132 1..132 582 97.7 Plus
Dyak\Syb-PA 153 GE21677-PA 44..127 46..129 317 76.2 Plus

GH19566.hyp Sequence

Translation from 504 to 911

> GH19566.hyp
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE*

GH19566.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
nSyb-PI 135 CG17248-PI 1..135 1..135 682 100 Plus
nSyb-PH 135 CG17248-PH 1..135 1..135 682 100 Plus
nSyb-PG 192 CG17248-PG 1..132 1..132 661 99.2 Plus
nSyb-PE 192 CG17248-PE 1..132 1..132 661 99.2 Plus
nSyb-PK 125 CG17248-PK 2..121 11..130 603 100 Plus