Clone GH19567 Report

Search the DGRC for GH19567

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:195
Well:67
Vector:pOT2
Associated Gene/TranscriptCG13698-RB
Protein status:GH19567.pep: gold
Preliminary Size:1717
Sequenced Size:1706

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13698 2001-01-01 Release 2 assignment
CG13698 2001-07-04 Blastp of sequenced clone
CG13698 2003-01-01 Sim4 clustering to Release 3
CG13698 2008-04-29 Release 5.5 accounting
CG13698 2008-08-15 Release 5.9 accounting
CG13698 2008-12-18 5.12 accounting

Clone Sequence Records

GH19567.complete Sequence

1706 bp (1706 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051547

> GH19567.complete
CCGCGCTGGCCGCATTAAAATCCGAGCTACGGAACTTCGCTGTTTCGCCT
CTTGTACGTGGGCTAACTTAAAACAAAAGTGGCTTGCGCAGCCGGCGCGC
CTTGAAAGTGTGTGTGTGTTCGTGTTTAAAAAAATAGTGTGCGTTATTGA
AAAGCTAAGTCAGTTAGAAGCAGTGTGGAAAGTGCATATTGTATATATCT
CTTGCCAAGGCTAAAAGTGTTAAAAGTTAACTCCCAGAAATGCACACACG
CATACCGATGCAAGCGAAAAGTTAAAGCGACGATCATTCATTACTGCGTC
TTCTTCTTATTCATCTGCTCTTTGCGACGTGTTTCGCTTACCTGTCCAAA
AAGCCCGAGTATTGGTGGGCTCCACAGCTCCATAGCTCCCTCTCTCTCTC
GCTCTCTTTCGATTTGCACATGCAAAAAGGCAGCAGCAGCAAGAACAACA
ACAAAAACTCCATCTGAGAGCTTTAAAGCCGAAGTTCTCGACGCAGACGT
CGGCGGGAGCAGAGCTTCAGCAGCGCAGCGGCAGCGAACAACTCGTACAG
ATAGGGAAATTCCTTGAGTCATGGACTATAGCAGAAGGAAAATAAGAGAT
TCTCTAATTGAAATGGATTCATAAAATCAGTTAAAACTCGTTGGATCTCA
ATTGCATTGTTATCGTTATGCTGTACAGTAAAACATGGCAAAGTCGACAC
TTTATGCTGCTGGGGTGACCTGTCTGGGCTTTATTTGCTTCGCCTTGGCA
TCTGTGGCCATTGGCATACCCATTTGGGGTTACTACGATAGTCCATCGGG
CGGCTATGACTTCGATCGAGGTTATTTCGGACCGTTTAAGGTCTGCAAGC
AATTGACTTATAATCGCGAGAAATGCGGCAACGACGTGTCCAAGTTTAGA
TTAAGTAATGCGGTTTTTGTCAGTGGACTCTTGGCCATTGGCAGCTCAGC
TGTGCTGGGCATCTTCTGCATTCTGTCGGTCATTCAACACGCGATGATCT
CATCCAGGGAGAAGGTGGTTATGCCCTACACAACTCTAGTGATAGTGAAG
TTAATGTTGGCATTGCTGGGAGGTGTACTGGCCATCATAGCGACGGTTTT
GTTTGCTCTGCAAATTGATGAGCAGGAGCGCTATGGCTTCAAGATATCGC
GGGGCATTTCCTTCTATATACAGATTGTGGCTATTGTTTTGACAATTGCT
CTGTTCGTGGCCGCCCTGTACGATGTGATCTACTCGCGCAGTCCAGGCGG
AGATCCCACAATGGCGCTGGATGTGTCATCTCCGGGCAGTGCCACTACGT
TCAATAATCCTGGTTTCAAGGAGCCTCGCAGTCGCAACGGCGTTTCGGTG
ACGGACGCATCCGGTAAGCCCTACAGCGGAATCCGGAATGGAGCGGGAAC
GGCGGGCAGCGTGGCCTCCATGAGCACCACCGTGACCAGCGTGTCCAATG
GATCCACCCTTGACTCGGTGACTCGTTCACCGCTGCGATCGAGTCTGAAG
AAGCCGAGACCACGGCCGGATCCAACGTTAGGCATTCAAAATCCCGGCTA
TTCTGGATCCGGAAGCTCGCCACCTATGCGGCGCAATGGAAGCGTGAAGA
AGGTCCGAATTCAGACGCACAGCACCGAGGTGTAAGATGGTTTCAACCAA
CTAGAATTAAGCCCTTCAACAAGCAGCAAACGACAAAAAAAAAAAAAAAA
AAAAAA

GH19567.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698.a 2439 CG13698.a 37..1742 1..1706 8500 99.8 Plus
CG13698-RB 2240 CG13698-RB 47..1752 1..1706 8500 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18095267..18095816 550..1 2750 100 Minus
chr3L 24539361 chr3L 18078820..18079334 1684..1170 2575 100 Minus
chr3L 24539361 chr3L 18079697..18079864 1075..908 840 100 Minus
chr3L 24539361 chr3L 18080135..18080298 800..637 820 100 Minus
chr3L 24539361 chr3L 18079967..18080075 907..799 545 100 Minus
chr3L 24539361 chr3L 18079534..18079636 1173..1071 515 100 Minus
chr3L 24539361 chr3L 18089092..18089180 636..548 445 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-RC 951 CG13698-PC 1..951 685..1635 4755 100 Plus
CG13698-RB 951 CG13698-PB 1..951 685..1635 4755 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:59:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-RB 2418 CG13698-RB 20..1703 1..1684 8420 100 Plus
CG13698-RC 1617 CG13698-RC 570..1617 637..1684 5240 100 Plus
CG13698-RC 1617 CG13698-RC 20..569 1..550 2750 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-PC 316 CG13698-PC 1..316 685..1632 1323 100 Plus
CG13698-PB 316 CG13698-PB 1..316 685..1632 1323 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18105581..18106130 550..1 2750 100 Minus
3L 28110227 3L 18089110..18089646 1706..1170 2655 99.6 Minus
3L 28110227 3L 18090009..18090176 1075..908 840 100 Minus
3L 28110227 3L 18090447..18090610 800..637 820 100 Minus
3L 28110227 3L 18090279..18090387 907..799 545 100 Minus
3L 28110227 3L 18089846..18089948 1173..1071 515 100 Minus
3L 28110227 3L 18099401..18099489 636..548 445 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18098681..18099230 550..1 2750 100 Minus
3L 28103327 3L 18082210..18082746 1706..1170 2655 99.6 Minus
3L 28103327 3L 18083109..18083276 1075..908 840 100 Minus
3L 28103327 3L 18083547..18083710 800..637 820 100 Minus
3L 28103327 3L 18083379..18083487 907..799 545 100 Minus
3L 28103327 3L 18082946..18083048 1173..1071 515 100 Minus
3L 28103327 3L 18092501..18092589 636..548 445 100 Minus
Blast to na_te.dros performed 2014-11-26 18:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2402..2527 422..549 165 63.8 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3249..3358 380..486 127 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2629..2670 426..467 120 76.2 Plus

GH19567.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:12:38 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18095267..18095816 1..550 100   Minus
chr3L 18089092..18089177 551..636 100 <- Minus
chr3L 18080136..18080298 637..799 100 <- Minus
chr3L 18079967..18080074 800..907 100 <- Minus
chr3L 18079700..18079864 908..1072 100 <- Minus
chr3L 18079534..18079634 1073..1173 100 <- Minus
chr3L 18078820..18079330 1174..1684 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:23:29 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 1..951 685..1635 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:25:16 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 1..951 685..1635 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:36:15 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 1..951 685..1635 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:58:16 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 1..951 685..1635 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:38 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 1..951 685..1635 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:23:29 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 1..1684 1..1684 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:25:16 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 1..1684 1..1684 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:36:15 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 20..1703 1..1684 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:58:16 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 1..1684 1..1684 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:38 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 20..1703 1..1684 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:12:38 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18105581..18106130 1..550 100   Minus
3L 18099401..18099486 551..636 100 <- Minus
3L 18090448..18090610 637..799 100 <- Minus
3L 18090279..18090386 800..907 100 <- Minus
3L 18090012..18090176 908..1072 100 <- Minus
3L 18089846..18089946 1073..1173 100 <- Minus
3L 18089132..18089642 1174..1684 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:36:15 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18098681..18099230 1..550 100   Minus
arm_3L 18092501..18092586 551..636 100 <- Minus
arm_3L 18083548..18083710 637..799 100 <- Minus
arm_3L 18083379..18083486 800..907 100 <- Minus
arm_3L 18083112..18083276 908..1072 100 <- Minus
arm_3L 18082946..18083046 1073..1173 100 <- Minus
arm_3L 18082232..18082742 1174..1684 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:36:03 Download gff for GH19567.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18098681..18099230 1..550 100   Minus
3L 18092501..18092586 551..636 100 <- Minus
3L 18083548..18083710 637..799 100 <- Minus
3L 18083379..18083486 800..907 100 <- Minus
3L 18083112..18083276 908..1072 100 <- Minus
3L 18082946..18083046 1073..1173 100 <- Minus
3L 18082232..18082742 1174..1684 100 <- Minus

GH19567.pep Sequence

Translation from 684 to 1634

> GH19567.pep
MAKSTLYAAGVTCLGFICFALASVAIGIPIWGYYDSPSGGYDFDRGYFGP
FKVCKQLTYNREKCGNDVSKFRLSNAVFVSGLLAIGSSAVLGIFCILSVI
QHAMISSREKVVMPYTTLVIVKLMLALLGGVLAIIATVLFALQIDEQERY
GFKISRGISFYIQIVAIVLTIALFVAALYDVIYSRSPGGDPTMALDVSSP
GSATTFNNPGFKEPRSRNGVSVTDASGKPYSGIRNGAGTAGSVASMSTTV
TSVSNGSTLDSVTRSPLRSSLKKPRPRPDPTLGIQNPGYSGSGSSPPMRR
NGSVKKVRIQTHSTEV*

GH19567.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25218-PA 316 GF25218-PA 1..316 1..316 1605 96.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15758-PA 316 GG15758-PA 1..316 1..316 1628 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16711-PA 317 GH16711-PA 1..317 1..316 1485 94 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-PC 316 CG13698-PC 1..316 1..316 1602 100 Plus
CG13698-PB 316 CG13698-PB 1..316 1..316 1602 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13791-PA 281 GI13791-PA 1..281 1..316 1327 82.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22724-PA 277 GL22724-PA 1..277 1..316 1358 85.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12466-PA 316 GA12466-PA 1..316 1..316 1595 96.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14955-PA 316 GM14955-PA 1..316 1..316 1636 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12353-PA 316 GD12353-PA 1..316 1..316 1637 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11660-PA 316 GJ11660-PA 1..316 1..316 1502 94.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16975-PA 321 GK16975-PA 1..321 1..316 1445 92.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22090-PA 316 GE22090-PA 1..316 1..316 1628 98.4 Plus

GH19567.hyp Sequence

Translation from 684 to 1634

> GH19567.hyp
MAKSTLYAAGVTCLGFICFALASVAIGIPIWGYYDSPSGGYDFDRGYFGP
FKVCKQLTYNREKCGNDVSKFRLSNAVFVSGLLAIGSSAVLGIFCILSVI
QHAMISSREKVVMPYTTLVIVKLMLALLGGVLAIIATVLFALQIDEQERY
GFKISRGISFYIQIVAIVLTIALFVAALYDVIYSRSPGGDPTMALDVSSP
GSATTFNNPGFKEPRSRNGVSVTDASGKPYSGIRNGAGTAGSVASMSTTV
TSVSNGSTLDSVTRSPLRSSLKKPRPRPDPTLGIQNPGYSGSGSSPPMRR
NGSVKKVRIQTHSTEV*

GH19567.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-PC 316 CG13698-PC 1..316 1..316 1602 100 Plus
CG13698-PB 316 CG13698-PB 1..316 1..316 1602 100 Plus