Clone GH19857 Report

Search the DGRC for GH19857

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:198
Well:57
Vector:pOT2
Associated Gene/TranscriptCG11200-RA
Protein status:GH19857.pep: gold
Preliminary Size:1709
Sequenced Size:1703

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11200 2001-01-01 Release 2 assignment
CG11200 2001-12-12 Blastp of sequenced clone
CG11200 2003-01-01 Sim4 clustering to Release 3
CG11200 2008-04-29 Release 5.5 accounting
CG11200 2008-08-15 Release 5.9 accounting
CG11200 2008-12-18 5.12 accounting

Clone Sequence Records

GH19857.complete Sequence

1703 bp (1703 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070514

> GH19857.complete
CTGGTGCCATCGATGTATATCCACCTTGGATTTTCGCTTGTCTGCAGTTA
TTTCAATTAAGTTGTTTCAAATCAGCGTTTTTGTGAGTGCACACTAAGCT
GTTTTTCTGCGTGATCAGCCGGCAAGTGGGTAAAATTCACCTGTTGACCA
GCGGCAATAAGCCAAAACAAAACAACAACAATCGTGGATCAAGTTCTTGG
CGGAAAGGCGCGCAATTAAAACCTAACGTTCAGTTCGCTTTTGAATTTCT
CGCCGAGCGGTTGTGGCGAAAATAAGGGCCCGCTGGAAAAACCGGTTTTC
AAACACCAGCGATTGATCCTCTTCGAAAACGTGAAAGAAAACAAAAAGAC
GAGGAAGCGCCGCCGCAGCCTTTAATTGAAAAAAAAGGGTGTCAATATTA
GCATAGAAATCGAGGCACAGGTGCATTTTCGTCTGCGTCAGCCAAATTGA
AGAGTTCCGGAGAGACGGCGATCCGATCCGATAAGAGCGTATAATGTTGG
GAACTTTGCTGTGGATTTTCTTCGTCGGCCTGCTGCTGTGTGCGTTCCTC
TTTTCGAAGACCACCAAGGAGTTCCCGAAGTCCTGGTTCGAGTGGAAGAC
TGAGTTTCGGTATCAGTACCTGGGAATCGTTGGGCTCGTCCACGATGCCC
AGTATAAGGCACGGGATCGAGTGGCACTTTATAAACAACCGGACCGCATT
GCTGTCATCACCGGAGGCAATCGCGGCATCGGACTGCGGATCGTGGAGAA
GCTGCTGGCCTGCGACATGACTGTCGTCATGGGCGTTCGTGATCCCAAAA
TTGCCGAAACCGCAGTTGCATCGATAGTCGACTTGAATGCTACCAAGGGC
AAGCTCATCTGCGAGCAACTGGATGTTGGGGATCTGAAATCCGTAAAGGC
ATTTGCTCAGCTCATCAAGGAGCGGTATTCAAAAGTGGATTTGTTGCTGA
ACAATGCTGGCATCATGTTTGCGCCCTTCAAACTAACCGCCGATGGCTAC
GAGTCGCACTTTGCCATCAACTTCCTGGGACACTTTCTGCTCACCCACCT
GCTTCTGCCTCAATTGAGGGCGGCAGGCAAGGAGGGAAGGAACTCCAGGA
TCGTGAACGTCAGCTCCTGCGTGAATCTCATTGGACGCATCAACTATAAG
GACATTAACGGAACAAAACACTATTACCCGGGAACCGCCTACAGTCAGTC
AAAGCTTGCTCAGATCTTGTTCACCCGCCATCTGCAGACACTGCTGGATG
CAGAAAAGTCGCACGTGCAGGTCAATGTGGTGCATCCGGGCATTGTGGAC
ACGGATCTGTTCGAGCACTCGGCCACCACATCGGTGCCCATTTTCAAGAA
GCTATTCTTCAAGACTCCGGAAAGGGGATCCCGCACGGTGGTCTTCGCGG
CCATTGATCCCTCCATCGAGGGTCAGGGTGGTACTTACCTCTCCAACGGC
GGAAAGGGTCCTTTCCATCCGGATGCCAAGAAGCCGGCAAAGTGCGAGCA
GCTTTTCCAGTTCTCCTGCGACCTGTTGAAAATCCAGCAGTACGGAAATG
GCGAATACTAAATGAACTCCACACTCAGTCTATCTCACATTCCTCCTACT
GGTGCAACGTACTTTTCTAGATACCGTCAGCTTTTTTGTAAATCGATTTC
TTTTGTATAAAAACATTTTTATATAGAAAAAAAAAAAAAAAAAAAAAAAA
AAA

GH19857.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-RB 1690 CG11200-RB 8..1684 1..1678 8350 99.9 Plus
CG11200-RA 1748 CG11200-RA 162..1742 97..1678 7870 99.9 Plus
CG11200-RA 1748 CG11200-RA 5..102 1..98 490 100 Plus
CG8920-RE 3293 CG8920-RE 1..62 735..674 310 100 Minus
CG8920-RE 3293 CG8920-RE 125..179 674..620 275 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16191576..16192088 1676..1165 2425 98.6 Minus
chr2R 21145070 chr2R 16192146..16192528 1164..782 1780 97.7 Minus
chr2R 21145070 chr2R 16195182..16195536 452..97 1685 98.9 Minus
chr2R 21145070 chr2R 16193469..16193696 674..447 1110 99.1 Minus
chr2R 21145070 chr2R 16193297..16193406 783..674 550 100 Minus
chr2R 21145070 chr2R 16195596..16195693 98..1 490 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-RC 1068 CG11200-PC 1..1068 494..1561 5340 100 Plus
CG11200-RA 1068 CG11200-PA 1..1068 494..1561 5340 100 Plus
CG11200-RB 1068 CG11200-PB 1..1068 494..1561 5340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:59:56 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-RB 1688 CG11200-RB 14..1688 1..1676 8330 99.9 Plus
CG11200-RA 1447 CG11200-RA 1..1447 229..1676 7190 99.9 Plus
CG11200-RC 1335 CG11200-RC 109..1335 450..1676 6135 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-PC 355 CG11200-PC 1..355 494..1558 1754 100 Plus
CG11200-PA 355 CG11200-PA 1..355 494..1558 1754 100 Plus
CG11200-PB 355 CG11200-PB 1..355 494..1558 1754 100 Plus
CG3842-PD 406 CG3842-PD 75..351 695..1528 395 40.8 Plus
CG3842-PC 406 CG3842-PC 75..351 695..1528 395 40.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20304515..20305028 1678..1165 2570 100 Minus
2R 25286936 2R 20305086..20305468 1164..782 1915 100 Minus
2R 25286936 2R 20308147..20308501 452..97 1730 99.7 Minus
2R 25286936 2R 20306415..20306642 674..447 1125 99.6 Minus
2R 25286936 2R 20306243..20306352 783..674 550 100 Minus
2R 25286936 2R 20308561..20308658 98..1 490 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20305714..20306227 1678..1165 2570 100 Minus
2R 25260384 2R 20306285..20306667 1164..782 1915 100 Minus
2R 25260384 2R 20309346..20309700 452..97 1740 99.7 Minus
2R 25260384 2R 20307614..20307841 674..447 1125 99.5 Minus
2R 25260384 2R 20307442..20307551 783..674 550 100 Minus
2R 25260384 2R 20309760..20309857 98..1 490 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:00:34 has no hits.

GH19857.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:16:19 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16195596..16195693 1..98 100   Minus
chr2R 16195182..16195534 99..452 98 <- Minus
chr2R 16193469..16193690 453..674 99 <- Minus
chr2R 16193298..16193405 675..782 100 <- Minus
chr2R 16192146..16192527 783..1164 97 <- Minus
chr2R 16191576..16192088 1165..1676 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:49:41 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RA 1..1068 494..1561 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:18:36 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RA 1..1068 494..1561 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:15 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 1..1068 494..1561 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:44:44 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RA 1..1068 494..1561 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:16:19 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 1..1068 494..1561 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:51:40 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 8..1682 1..1676 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:18:36 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 8..1682 1..1676 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:15 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 14..1688 1..1676 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:44:44 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 8..1682 1..1676 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:16:19 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 14..1688 1..1676 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:16:19 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20308561..20308658 1..98 100   Minus
2R 20308147..20308499 99..452 99 <- Minus
2R 20306415..20306636 453..674 100 <- Minus
2R 20306244..20306351 675..782 100 <- Minus
2R 20305086..20305467 783..1164 100 <- Minus
2R 20304517..20305028 1165..1676 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:15 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16196066..16196163 1..98 100   Minus
arm_2R 16195652..16196004 99..452 99 <- Minus
arm_2R 16193920..16194141 453..674 100 <- Minus
arm_2R 16193749..16193856 675..782 100 <- Minus
arm_2R 16192591..16192972 783..1164 100 <- Minus
arm_2R 16192022..16192533 1165..1676 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:21:01 Download gff for GH19857.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20309760..20309857 1..98 100   Minus
2R 20309346..20309698 99..452 99 <- Minus
2R 20307614..20307835 453..674 100 <- Minus
2R 20307443..20307550 675..782 100 <- Minus
2R 20306285..20306666 783..1164 100 <- Minus
2R 20305716..20306227 1165..1676 100 <- Minus

GH19857.pep Sequence

Translation from 493 to 1560

> GH19857.pep
MLGTLLWIFFVGLLLCAFLFSKTTKEFPKSWFEWKTEFRYQYLGIVGLVH
DAQYKARDRVALYKQPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRD
PKIAETAVASIVDLNATKGKLICEQLDVGDLKSVKAFAQLIKERYSKVDL
LLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEGRN
SRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTL
LDAEKSHVQVNVVHPGIVDTDLFEHSATTSVPIFKKLFFKTPERGSRTVV
FAAIDPSIEGQGGTYLSNGGKGPFHPDAKKPAKCEQLFQFSCDLLKIQQY
GNGEY*

GH19857.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 00:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12671-PA 355 GF12671-PA 1..354 1..354 1747 93.2 Plus
Dana\GF13188-PA 331 GF13188-PA 46..296 68..318 444 39.8 Plus
Dana\GF20918-PA 391 GF20918-PA 62..350 62..347 429 38.7 Plus
Dana\GF13192-PA 293 GF13192-PA 16..262 68..318 408 40.2 Plus
Dana\GF13190-PA 328 GF13190-PA 41..317 65..341 401 37.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 00:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20867-PA 355 GG20867-PA 1..354 1..354 1771 96 Plus
Dere\GG23292-PA 296 GG23292-PA 8..275 64..328 448 38 Plus
Dere\GG19587-PA 405 GG19587-PA 66..353 63..347 447 41.2 Plus
Dere\GG23293-PA 327 GG23293-PA 43..296 65..318 409 40.5 Plus
Dere\GG23291-PA 331 GG23291-PA 43..319 65..341 408 37.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 00:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20061-PA 356 GH20061-PA 15..354 16..355 1609 89.1 Plus
Dgri\GH21880-PA 325 GH21880-PA 44..304 68..328 435 39.4 Plus
Dgri\GH21882-PA 325 GH21882-PA 44..304 68..328 433 39.6 Plus
Dgri\GH21876-PA 334 GH21876-PA 46..296 68..318 429 41.3 Plus
Dgri\GH21881-PA 304 GH21881-PA 25..275 69..318 424 40.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 00:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-PC 355 CG11200-PC 1..355 1..355 1848 100 Plus
CG11200-PA 355 CG11200-PA 1..355 1..355 1848 100 Plus
CG11200-PB 355 CG11200-PB 1..355 1..355 1848 100 Plus
CG3842-PD 406 CG3842-PD 75..351 68..345 463 40.8 Plus
CG3842-PC 406 CG3842-PC 75..351 68..345 463 40.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 00:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18778-PA 354 GI18778-PA 13..352 16..355 1629 87.1 Plus
Dmoj\GI15186-PA 397 GI15186-PA 60..342 62..341 452 40.7 Plus
Dmoj\GI20381-PA 417 GI20381-PA 131..407 65..341 448 38.7 Plus
Dmoj\GI24262-PA 336 GI24262-PA 49..329 64..347 312 30.4 Plus
Dmoj\GI16896-PA 408 GI16896-PA 122..373 68..318 228 27.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 00:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16836-PA 355 GL16836-PA 1..355 1..355 1718 91.5 Plus
Dper\GL20020-PA 332 GL20020-PA 43..296 65..318 419 40.1 Plus
Dper\GL11532-PA 327 GL11532-PA 44..317 68..341 382 37 Plus
Dper\GL20021-PA 296 GL20021-PA 15..288 68..341 381 37.2 Plus
Dper\GL26852-PA 356 GL26852-PA 66..329 63..354 299 33.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 00:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10835-PB 355 GA10835-PB 1..355 1..355 1718 91.5 Plus
Dpse\GA10835-PA 355 GA10835-PA 1..355 1..355 1718 91.5 Plus
Dpse\GA17725-PA 394 GA17725-PA 66..367 63..354 457 40.5 Plus
Dpse\GA15878-PA 332 GA15878-PA 43..296 65..318 420 40.5 Plus
Dpse\GA15882-PB 324 GA15882-PB 43..316 68..341 388 37.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 00:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19792-PA 355 GM19792-PA 1..355 1..355 1874 98.6 Plus
Dsec\GM12483-PA 403 GM12483-PA 66..351 63..345 435 40.8 Plus
Dsec\GM20970-PA 325 GM20970-PA 44..311 68..329 417 39.3 Plus
Dsec\GM20968-PA 331 GM20968-PA 43..319 65..341 403 36.8 Plus
Dsec\GM20972-PA 330 GM20972-PA 44..304 68..328 389 38.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 00:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25284-PA 355 GD25284-PA 1..355 1..355 1885 99.4 Plus
Dsim\GD10499-PA 325 GD10499-PA 41..311 65..329 415 38.5 Plus
Dsim\GD10497-PA 331 GD10497-PA 43..319 65..341 402 36.8 Plus
Dsim\GD10500-PA 329 GD10500-PA 37..294 64..318 386 38.9 Plus
Dsim\GD10498-PA 327 GD10498-PA 39..296 64..318 380 37 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 00:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21805-PA 354 GJ21805-PA 2..352 5..355 1654 85.2 Plus
Dvir\GJ17066-PA 358 GJ17066-PA 54..336 62..341 446 37.2 Plus
Dvir\GJ17067-PA 390 GJ17067-PA 59..347 62..347 425 39.1 Plus
Dvir\GJ22105-PA 333 GJ22105-PA 43..296 65..318 420 40.5 Plus
Dvir\GJ22106-PA 327 GJ22106-PA 44..317 68..341 419 37.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 00:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19530-PA 355 GK19530-PA 1..355 1..355 1626 89.9 Plus
Dwil\GK14729-PA 247 GK14729-PA 1..217 96..318 450 45.4 Plus
Dwil\GK19885-PA 404 GK19885-PA 66..370 62..353 446 38.5 Plus
Dwil\GK18888-PA 278 GK18888-PA 7..275 68..348 436 39.1 Plus
Dwil\GK14727-PA 336 GK14727-PA 57..301 68..318 430 41.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 00:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13807-PA 355 GE13807-PA 1..354 1..354 1777 96.6 Plus
Dyak\GE16748-PA 407 GE16748-PA 66..351 63..345 441 41.2 Plus
Dyak\GE19139-PA 326 GE19139-PA 44..294 68..318 414 39.9 Plus
Dyak\GE19137-PA 331 GE19137-PA 43..319 65..341 403 36.5 Plus
Dyak\GE19140-PA 329 GE19140-PA 37..294 64..318 390 38.5 Plus

GH19857.hyp Sequence

Translation from 493 to 1560

> GH19857.hyp
MLGTLLWIFFVGLLLCAFLFSKTTKEFPKSWFEWKTEFRYQYLGIVGLVH
DAQYKARDRVALYKQPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRD
PKIAETAVASIVDLNATKGKLICEQLDVGDLKSVKAFAQLIKERYSKVDL
LLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEGRN
SRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTL
LDAEKSHVQVNVVHPGIVDTDLFEHSATTSVPIFKKLFFKTPERGSRTVV
FAAIDPSIEGQGGTYLSNGGKGPFHPDAKKPAKCEQLFQFSCDLLKIQQY
GNGEY*

GH19857.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-PC 355 CG11200-PC 1..355 1..355 1848 100 Plus
CG11200-PA 355 CG11200-PA 1..355 1..355 1848 100 Plus
CG11200-PB 355 CG11200-PB 1..355 1..355 1848 100 Plus
CG3842-PD 406 CG3842-PD 75..351 68..345 463 40.8 Plus
CG3842-PC 406 CG3842-PC 75..351 68..345 463 40.8 Plus