Clone GH22991 Report

Search the DGRC for GH22991

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:229
Well:91
Vector:pOT2
Associated Gene/Transcripttx-RA
Protein status:GH22991.pep: gold
Preliminary Size:1983
Sequenced Size:1892

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5441 2001-01-01 Release 2 assignment
CG5441 2001-07-04 Blastp of sequenced clone
dei 2008-04-29 Release 5.5 accounting
dei 2008-08-15 Release 5.9 accounting
dei 2008-12-18 5.12 accounting

Clone Sequence Records

GH22991.complete Sequence

1892 bp (1892 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051581

> GH22991.complete
TTAAACCAGCGGCGCAATCACAACCGCAACAACCACAACCACCGCAATAT
TAATTCAAACCAAAACAAGTTCCAGAAGTTTTTGAGGAAATAAAAACTGA
AAACAAACCTTTTTTTGTTGTGTTAACATGCCAAATTTATGCATGAGCTA
ATAACTTTAAATCCGAAAAGAATAAAAAAAAGTCCAAACAAAACAAAATT
CAAACAAAGATCGCATATCAAAATTAGTTGGGTGACTAATTAGACAGCGC
GTTGTCGGAATTTCAATTTGCATACTTTGGCGCAACTTTAATGAACCAAA
AATTAAAATAAAAACATCAACAAATCTTAATCAGAGTGCACAACTGAATT
CAAATCATCCTGAAAGACCAATCCCGCAGCCATACATTGTTGGATTTATG
AAATCAAAAAGATGAAGTCCAATACGTACGAACTGCACAACTACGCCGAT
CTGAATGACATGGCCAGAGCGACGGACTCCAAGGATTCGCGCAAAAGGAA
GACGGCCAGTGCTCGGGGCGAGAAGTATTCCCTGCGACAGAAGCGACAAA
AGAGGGGCTCCAACGAGGATGGGGAGTCAGCCAACCTGGCTGACTTTCAA
CTAGAATTAGATCCCATAGCGGAGCCGGCTAGTAAATCGAGGAAAAATGC
ACCCACCAAGTCCAAGACGAAAGCACCGCCACTGAGTAAATACCGTCGGA
AAACAGCGAATGCCAGGGAGCGAACCAGAATGCGTGAGATCAACACGGCC
TTTGAGACACTGAGGCATTGTGTTCCCGAAGCGATCAAGGGCGAGGATGC
GGCCAATACCAACGAGAAGCTGACCAAAATCACCACCCTGAGACTGGCCA
TGAAGTACATCACCATGCTGACCGACTCGATTCGAGATCCCAGCTATGAA
AGCGAATTTATAGGGGAGTGTCTGGAGGAGAGTGCCAATCGGGAGGCGAG
AGTGGACTTGGAAGCGAACGAGGAAGCCGAGGTGGAGCTACCCGTTCCAG
TTGCCAAGAAGCCAGCCAAGACAAAGGGCAGTGGTAAGAAGAGTTCCGCC
GCGAGCAAAAGACAGAGCCAAAAGCAGGCCAAGATAGTGCCCCAGATACC
ACCGATAAGTTCCGGTGAGTCGTGCTACGCCACCTCTTCGATTGGATCGC
CTGCCTCCTCCGCCTACGCATCGCTCTCCTCGTCATCGAACAGCCACAGC
AGCAGTAGCAGTCCGGGACTGGAGCTGGACAGTCTGGTGGGATTGAACGG
AATCAGCGCCCTGGACTCTCTGCTTCTGGATACCTCCGATGGGGATTCCC
TCTCCTGTCTAAGTCCCGGCTATGGAAGTCTACTCACTGGCAGCGGGGAA
TCCCTGTTGCCCGGTTGCCGAGGTGATCTGCCCATGTCGGGTCTGGAGAA
GTCGGATGTGGAGCTCAGTCTGCGATTACTGGACCAGAGTTCCAAGGATT
CCTTCGACTTTGCCAGCGATCAGCAGCCGTCGGCCTGTATTAGTTCGTTC
TCCGCTCTGGATGGGTATCCATTCGACCTGCTGCACAGCGATTTTCCGGA
TATGTTTCTCACGTGACGCGTATTTCTTAGCAACCCTAACTACTCTCCTT
TTAAGCCTAACCCTCGTCTTAAGTTAGAGTGCGAGTTTTAACCCGACTTT
CACTATTAGCCATTACATGCGATGCGCCATTGAGGCGGAATTCATTGTGT
CATAGCAAGCAGCTGACAGGATAAGTATATTCACATCCTGCGAAGGCAAA
AGCTGCTCACCGCCACATCCACATGATAGCTCAACTCAACTAGTGATTTA
AGCATTTCTTTGTGACGCATTTCTCGTTATCCTGTAAATAAAGCACCCAG
TGTTGATTCAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH22991.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
dei.a 2629 dei.a 694..2557 1..1865 9285 99.9 Plus
dei-RA 2031 dei-RA 96..1959 1..1865 9285 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22270564..22272017 410..1863 7255 99.9 Plus
chr3R 27901430 chr3R 22264349..22264758 1..411 2005 99.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
tx-RB 1155 CG5441-PB 1..1155 412..1566 5775 100 Plus
tx-RA 1155 CG5441-PA 1..1155 412..1566 5775 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:03:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
tx-RB 2411 CG5441-RB 550..2411 1..1863 9265 99.9 Plus
tx-RA 1652 CG5441-RA 1..1652 212..1863 8260 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
tx-PB 384 CG5441-PB 1..384 412..1563 1351 100 Plus
tx-PA 384 CG5441-PA 1..384 412..1563 1351 100 Plus
cato-PA 189 CG7760-PA 56..165 598..900 152 37.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26447538..26448993 410..1865 7280 100 Plus
3R 32079331 3R 26441327..26441736 1..411 2005 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26188369..26189824 410..1865 7280 100 Plus
3R 31820162 3R 26182158..26182567 1..411 2015 99.7 Plus
Blast to na_te.dros performed on 2014-11-26 22:45:49 has no hits.

GH22991.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:01:01 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22270566..22272017 412..1863 99   Plus
chr3R 22264349..22264758 1..411 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:53:10 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
dei-RA 1..1155 412..1566 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:24:21 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
dei-RA 1..1155 412..1566 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:56:05 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
tx-RA 1..1155 412..1566 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:57:13 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
dei-RA 1..1155 412..1566 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:01:01 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
tx-RA 1..1155 412..1566 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:22:22 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
dei-RA 1..1862 1..1863 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:24:21 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
dei-RA 1..1862 1..1863 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:56:05 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
tx-RA 132..1993 1..1863 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:57:14 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
dei-RA 1..1862 1..1863 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:01:01 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
tx-RB 550..2411 1..1863 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:01:01 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26447540..26448991 412..1863 100   Plus
3R 26441327..26441736 1..411 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:56:05 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22273262..22274713 412..1863 100   Plus
arm_3R 22267049..22267458 1..411 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:35:00 Download gff for GH22991.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26188371..26189822 412..1863 100   Plus
3R 26182158..26182567 1..411 99 -> Plus

GH22991.pep Sequence

Translation from 411 to 1565

> GH22991.pep
MKSNTYELHNYADLNDMARATDSKDSRKRKTASARGEKYSLRQKRQKRGS
NEDGESANLADFQLELDPIAEPASKSRKNAPTKSKTKAPPLSKYRRKTAN
ARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYI
TMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVAKK
PAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASS
AYASLSSSSNSHSSSSSPGLELDSLVGLNGISALDSLLLDTSDGDSLSCL
SPGYGSLLTGSGESLLPGCRGDLPMSGLEKSDVELSLRLLDQSSKDSFDF
ASDQQPSACISSFSALDGYPFDLLHSDFPDMFLT*

GH22991.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20734-PA 386 GF20734-PA 1..386 1..384 1437 77 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11475-PA 386 GG11475-PA 1..385 1..383 1747 93.8 Plus
Dere\GG22282-PA 189 GG22282-PA 83..165 73..163 156 39.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19416-PA 452 GH19416-PA 24..452 1..384 858 51 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
tx-PB 384 CG5441-PB 1..384 1..384 1931 100 Plus
tx-PA 384 CG5441-PA 1..384 1..384 1931 100 Plus
cato-PA 189 CG7760-PA 56..165 63..163 152 37.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22620-PA 418 GI22620-PA 1..418 1..384 902 54.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21846-PA 449 GL21846-PA 35..449 1..384 1131 65.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18883-PA 415 GA18883-PA 1..415 1..384 1134 65.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10319-PA 373 GM10319-PA 1..373 1..384 1591 91.7 Plus
Dsec\GM20070-PA 188 GM20070-PA 55..164 63..163 160 35.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21279-PA 386 GD21279-PA 1..386 1..384 1740 96.6 Plus
Dsim\GD25551-PA 188 GD25551-PA 55..164 63..163 168 37.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23868-PA 423 GJ23868-PA 14..423 1..384 907 56.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13968-PA 422 GK13968-PA 1..422 1..384 750 49 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23667-PA 387 GE23667-PA 1..387 1..384 1673 91.7 Plus
Dyak\GE14078-PA 189 GE14078-PA 83..165 73..163 156 39.6 Plus

GH22991.hyp Sequence

Translation from 411 to 1565

> GH22991.hyp
MKSNTYELHNYADLNDMARATDSKDSRKRKTASARGEKYSLRQKRQKRGS
NEDGESANLADFQLELDPIAEPASKSRKNAPTKSKTKAPPLSKYRRKTAN
ARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYI
TMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVAKK
PAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASS
AYASLSSSSNSHSSSSSPGLELDSLVGLNGISALDSLLLDTSDGDSLSCL
SPGYGSLLTGSGESLLPGCRGDLPMSGLEKSDVELSLRLLDQSSKDSFDF
ASDQQPSACISSFSALDGYPFDLLHSDFPDMFLT*

GH22991.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
tx-PB 384 CG5441-PB 1..384 1..384 1931 100 Plus
tx-PA 384 CG5441-PA 1..384 1..384 1931 100 Plus
cato-PA 189 CG7760-PA 56..165 63..163 152 37.6 Plus