Clone GH23180 Report

Search the DGRC for GH23180

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:231
Well:80
Vector:pOT2
Associated Gene/TranscriptPect-RB
Protein status:GH23180.pep: gold
Sequenced Size:1941

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Pect-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

GH23180.complete Sequence

1941 bp assembled on 2010-12-09

GenBank Submission: BT125823.1

> GH23180.complete
TGAACGTCGCTGTCGTCGAGTTTCCGCCTTCAAAACGAGCACTGAAAACA
GAAACATACTCTCCGGAATCTAATGTTCGCCCGTTAGCCGGATTCTAAAT
TAAAATTAAATTAAATTGTGAAAATTCAATAAGTCAACGATGGAGGCAAA
TGGCGATACCAGCGCCTGCAATGGGTATTCGGACAAGCAGCGGAAGGATG
TGCGCGTCTGGTGCGATGGATGCTATGATATGGTACACTTCGGACATGCC
AATTCTCTGCGACAAGCCAAGGCTCTTGGCGATAAGGTAATTGTGGGCAT
TCACACCGACGAGGAGATCACCAAGCACAAGGGACCACCGGTCTTCACCG
AGGAGGAGCGCGTCAAGATGGTCAAGGGCATCAAATGGGTGGATGAGGTG
GTGCTCGGTGCTCCGTATGTGACCACACTGGATGTGCTCGACCAGAACAA
CTGTGATTTCTGTGTGCATGGAGATGACATTACAATGACAGCCGAAGGAG
TGGACACATATCATTTGGTCAAATCAGCCAATCGCTACAAGGAAGTGAAA
CGCACAGCTGGAGTCTCGACCACTGACCTTGTGGGCCGCATGTTGCTCCT
GACACGCAACCACTTCCGTCAAGGATCCGCGGAATATGATATCGAGAAAG
AAGTGTCAATTTTAAAACGACAAATAAAATCCCATCCAGGTTCTTCGAAC
ATGGGTCAAGATTCGGCAGCCAAAAGTCCGTGGACCGGTTGTAGTCAGTT
CTTGCCGACTACCCAAAAGATCATACAGTTCAGTGATGGAAAGTCACCGA
ATCCCGGCGATAAGATTGTTTATGTGGCTGGCGCCTTCGATCTCTTCCAT
GTGGGTCACCTGGACTTTCTGGAAAAGGCTAAGAAACTGGGTGACTATCT
GATTGTTGGCCTGCACACAGATCCCGTGGTGAACTCCTACAAGGGCAGCA
ACTATCCCATTATGAATCTGCACGAGCGCGTGCTCAGTGTTTTGGCCTGC
AAGTTTGTCAATGAGGTAGTAATCGGAGCTCCCTACTGTGTCACTGAAGA
GCTGCTTGAGCACTTCAAAATCGATGTTGTCTGTCATGGACGCACACCCA
TTGCGCTTGAGAATGGCAAGATCGATCCATATGCCGTTCCCAAGACGCGA
GCCATCTTTGAGCTGATCGATTCCGGCAACGAGATGACCACGGAGCGCAT
CGTGGAGCGCATCATCTCGCACCGACTGGAATATGAGCGTCGCAATCAGG
CCAAAGAAAAGAAGGAAATCGAAGCCTTTGAGGCACTTCAACGCCAAAAA
CAGACCCAAAAGGCCGGCTAGCCGGAACCAGATTCCGACCTCTCACACTA
GACGGATGTTTTTTATTTTCTAGTTGCGTTCTTTTAGTTTGTTTTATTTA
GTTTGTCTTGTTTAGTATGTCGTCCCCTGATGATGGCGCTTTAATTTTTT
GTTGCGTAAAAAGCGAAGCGACGCTGCCTGAGGATTCAGCGCACCGCTCT
CTCGATTTCTAGTACAATTTTAGAATATCTGCACATGCGCCTTAATGATA
TAAGGTTATACACATAATTATATATTTCTAACACATTAACGTAGAATATT
TAAAATCTAAATTTTATGTATGTAAGCTCAAAATTTGTAAATTCCCTTTA
AAGTACGATGTAAGTGTGAGGAACAACAAAATTGTACGAATAGCATGTTA
TCCAAACTGTTGCCGAATTGAAAAGCCTTGTACGACTTGTATGTATATAT
ATTCAGCAACGGAAGTAGGATGCCTGGATCAGGAAGTAGCTGCTTTTATC
AAATGTAATCTCTGATACTTTGTCCTAATTTATTAATGCATATAGTAAGT
GCGAGTTCAAGTTTTATGTTTCCTTGTTTAATCTTAGACTTAAATACATG
GCCAAAAATATTGCGAATTCCAAAAAAAAAAAAAAAAAAAA

GH23180.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13208590..13209510 1002..1921 4540 99.8 Plus
chr2L 23010047 chr2L 13206790..13207041 222..473 1260 100 Plus
chr2L 23010047 chr2L 13202732..13202953 1..222 1110 100 Plus
chr2L 23010047 chr2L 13208341..13208526 818..1003 930 100 Plus
chr2L 23010047 chr2L 13208110..13208282 647..819 850 99.4 Plus
chr2L 23010047 chr2L 13207346..13207458 541..653 565 100 Plus
chr2L 23010047 chr2L 13207100..13207169 472..541 350 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Pect-RB 1182 CG5547-PB 1..1182 140..1321 5910 100 Plus
Pect-RD 1146 CG5547-PD 513..1146 688..1321 3170 100 Plus
Pect-RC 1125 CG5547-PC 512..1125 708..1321 3070 100 Plus
Pect-RD 1146 CG5547-PD 1..514 140..653 2570 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
Pect-RB 2210 CG5547-RB 290..2210 1..1921 9605 100 Plus
Pect-RD 2174 CG5547-RD 941..2174 688..1921 6170 100 Plus
Pect-RC 2153 CG5547-RC 940..2153 708..1921 6070 100 Plus
Pect-RD 2174 CG5547-RD 290..942 1..653 3265 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Pect-PB 393 CG5547-PB 1..393 140..1318 2003 100 Plus
Pect-PD 381 CG5547-PD 1..381 140..1318 1921 96.9 Plus
Pect-PC 374 CG5547-PC 1..374 140..1318 1878 95.2 Plus
Pect-PE 371 CG5547-PE 1..371 140..1318 1861 94.4 Plus
Cct2-PA 381 CG18330-PA 74..234 185..661 229 36.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13209909..13210842 1002..1935 4670 100 Plus
2L 23513712 2L 13208109..13208360 222..473 1260 100 Plus
2L 23513712 2L 13204051..13204272 1..222 1110 100 Plus
2L 23513712 2L 13209660..13209845 818..1003 930 100 Plus
2L 23513712 2L 13209429..13209601 647..819 850 99.4 Plus
2L 23513712 2L 13208665..13208777 541..653 565 100 Plus
2L 23513712 2L 13208419..13208488 472..541 350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13209909..13210842 1002..1935 4670 100 Plus
2L 23513712 2L 13208109..13208360 222..473 1260 100 Plus
2L 23513712 2L 13204051..13204272 1..222 1110 100 Plus
2L 23513712 2L 13209660..13209845 818..1003 930 100 Plus
2L 23513712 2L 13209429..13209601 647..819 850 99.4 Plus
2L 23513712 2L 13208665..13208777 541..653 565 100 Plus
2L 23513712 2L 13208419..13208488 472..541 350 100 Plus
Blast to na_te.dros performed 2014-11-27 16:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1b 5171 Rt1b RT1B 5150bp 112..172 130..70 134 68.9 Minus

GH23180.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:27 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13208592..13209510 1004..1921 99   Plus
chr2L 13208341..13208526 818..1003 100 -> Plus
chr2L 13208117..13208280 654..817 100 -> Plus
chr2L 13207346..13207458 541..653 100 -> Plus
chr2L 13207102..13207168 474..540 100 -> Plus
chr2L 13206791..13207041 223..473 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:17 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
Pect-RB 1..1182 140..1321 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:33:57 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
Pect-RB 1..1182 140..1321 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:27 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
Pect-RB 1..1182 140..1321 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:17 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
Pect-RB 284..2204 1..1921 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:33:57 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
Pect-RB 290..2210 1..1921 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:27 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
Pect-RB 290..2210 1..1921 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:27 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13209911..13210828 1004..1921 100   Plus
2L 13209660..13209845 818..1003 100 -> Plus
2L 13209436..13209599 654..817 100 -> Plus
2L 13208665..13208777 541..653 100 -> Plus
2L 13208421..13208487 474..540 100 -> Plus
2L 13208110..13208360 223..473 100 -> Plus
2L 13204051..13204272 1..222 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:33:57 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13209911..13210828 1004..1921 100   Plus
arm_2L 13209660..13209845 818..1003 100 -> Plus
arm_2L 13209436..13209599 654..817 100 -> Plus
arm_2L 13208665..13208777 541..653 100 -> Plus
arm_2L 13208421..13208487 474..540 100 -> Plus
arm_2L 13208110..13208360 223..473 100 -> Plus
arm_2L 13204051..13204272 1..222 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:22 Download gff for GH23180.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13209911..13210828 1004..1921 100   Plus
2L 13209660..13209845 818..1003 100 -> Plus
2L 13209436..13209599 654..817 100 -> Plus
2L 13208665..13208777 541..653 100 -> Plus
2L 13208421..13208487 474..540 100 -> Plus
2L 13208110..13208360 223..473 100 -> Plus
2L 13204051..13204272 1..222 100 -> Plus

GH23180.pep Sequence

Translation from 139 to 1320

> GH23180.pep
MEANGDTSACNGYSDKQRKDVRVWCDGCYDMVHFGHANSLRQAKALGDKV
IVGIHTDEEITKHKGPPVFTEEERVKMVKGIKWVDEVVLGAPYVTTLDVL
DQNNCDFCVHGDDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTDLVGR
MLLLTRNHFRQGSAEYDIEKEVSILKRQIKSHPGSSNMGQDSAAKSPWTG
CSQFLPTTQKIIQFSDGKSPNPGDKIVYVAGAFDLFHVGHLDFLEKAKKL
GDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAPYC
VTEELLEHFKIDVVCHGRTPIALENGKIDPYAVPKTRAIFELIDSGNEMT
TERIVERIISHRLEYERRNQAKEKKEIEAFEALQRQKQTQKAG*

GH23180.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15564-PA 393 GF15564-PA 6..393 3..393 1904 89.8 Plus
Dana\GF24774-PA 389 GF24774-PA 76..236 19..175 235 39.4 Plus
Dana\GF24772-PA 526 GF24772-PA 209..374 14..175 228 37.6 Plus
Dana\GF24774-PA 389 GF24774-PA 61..224 208..372 221 36.9 Plus
Dana\GF24772-PA 526 GF24772-PA 218..362 227..372 218 37.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23821-PA 384 GG23821-PA 6..384 3..393 1999 95.4 Plus
Dere\GG14798-PA 368 GG14798-PA 61..224 16..175 227 38.7 Plus
Dere\GG14797-PA 521 GG14797-PA 206..366 19..175 222 37.6 Plus
Dere\GG14797-PA 521 GG14797-PA 210..354 227..372 216 37.2 Plus
Dere\GG14798-PA 368 GG14798-PA 68..212 227..372 206 37.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11091-PA 385 GH11091-PA 11..385 3..393 1885 89.8 Plus
Dgri\GH14503-PA 571 GH14503-PA 253..418 14..175 228 37.1 Plus
Dgri\GH14503-PA 571 GH14503-PA 262..406 227..372 206 35.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Pect-PB 393 CG5547-PB 1..393 1..393 2072 100 Plus
Pect-PD 381 CG5547-PD 1..381 1..393 1990 96.9 Plus
Pect-PC 374 CG5547-PC 1..374 1..393 1947 95.2 Plus
Pect-PE 371 CG5547-PE 1..371 1..393 1930 94.4 Plus
Cct2-PA 381 CG18330-PA 74..234 16..174 229 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17607-PA 394 GI17607-PA 27..394 10..393 1908 93 Plus
Dmoj\GI13279-PA 575 GI13279-PA 253..421 14..178 236 38.2 Plus
Dmoj\GI13279-PA 575 GI13279-PA 262..406 227..372 211 37.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26305-PA 395 GL26305-PA 17..395 8..393 1910 91.8 Plus
Dper\GL24809-PA 417 GL24809-PA 101..271 12..178 246 39.4 Plus
Dper\GL24617-PA 357 GL24617-PA 58..227 14..178 229 37 Plus
Dper\GL24808-PA 531 GL24808-PA 210..375 14..175 225 37.6 Plus
Dper\GL24617-PA 357 GL24617-PA 67..212 227..372 215 37.2 Plus
Dper\GL24809-PA 417 GL24809-PA 112..256 227..372 214 37.8 Plus
Dper\GL24808-PA 531 GL24808-PA 219..363 227..372 206 35.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28810-PA 395 GA28810-PA 17..395 8..393 1910 91.8 Plus
Dpse\GA23519-PA 417 GA23519-PA 101..271 12..178 246 39.4 Plus
Dpse\GA23364-PA 391 GA23364-PA 94..263 14..178 230 37 Plus
Dpse\GA10348-PA 531 GA10348-PA 210..375 14..175 225 37.6 Plus
Dpse\GA23364-PA 391 GA23364-PA 103..248 227..372 216 37.2 Plus
Dpse\GA23519-PA 417 GA23519-PA 112..256 227..372 215 37.8 Plus
Dpse\GA10348-PA 531 GA10348-PA 219..363 227..372 206 35.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10235-PA 381 GM10235-PA 1..381 1..393 1884 91.6 Plus
Dsec\GM14419-PA 524 GM14419-PA 204..364 19..175 230 38.2 Plus
Dsec\GM14420-PA 380 GM14420-PA 73..236 16..175 228 38.1 Plus
Dsec\GM14419-PA 524 GM14419-PA 208..352 227..372 217 37.2 Plus
Dsec\GM14420-PA 380 GM14420-PA 80..224 227..372 211 37.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23872-PA 381 GD23872-PA 1..381 1..393 2031 96.7 Plus
Dsim\GD13623-PA 524 GD13623-PA 204..364 19..175 230 38.2 Plus
Dsim\GD13624-PA 381 GD13624-PA 74..237 16..175 228 38.1 Plus
Dsim\GD13623-PA 524 GD13623-PA 208..352 227..372 217 37.2 Plus
Dsim\GD13624-PA 381 GD13624-PA 81..225 227..372 211 37.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17952-PA 415 GJ17952-PA 31..415 4..393 1891 90.5 Plus
Dvir\GJ14914-PA 351 GJ14914-PA 1..351 31..393 1831 94.5 Plus
Dvir\GJ14912-PA 167 GJ14912-PA 1..167 227..393 866 96.4 Plus
Dvir\GJ12047-PA 368 GJ12047-PA 50..215 14..175 227 37.6 Plus
Dvir\GJ14912-PA 167 GJ14912-PA 1..160 23..178 208 33.1 Plus
Dvir\GJ12047-PA 368 GJ12047-PA 59..203 227..372 207 36.5 Plus
Dvir\GJ14914-PA 351 GJ14914-PA 182..344 20..178 205 33.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14544-PA 393 GK14544-PA 31..393 19..393 1898 94.7 Plus
Dwil\GK12565-PA 560 GK12565-PA 231..391 19..175 226 37.6 Plus
Dwil\GK12565-PA 560 GK12565-PA 216..379 208..372 211 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Pect-PA 384 GE18624-PA 6..384 3..393 2005 95.9 Plus
Dyak\GE21160-PA 380 GE21160-PA 74..240 16..178 236 38.6 Plus
Dyak\GE21159-PA 520 GE21159-PA 199..364 14..175 230 37.6 Plus
Dyak\GE21159-PA 520 GE21159-PA 208..352 227..372 217 37.2 Plus
Dyak\GE21160-PA 380 GE21160-PA 81..225 227..372 214 37.8 Plus

GH23180.hyp Sequence

Translation from 139 to 1320

> GH23180.hyp
MEANGDTSACNGYSDKQRKDVRVWCDGCYDMVHFGHANSLRQAKALGDKV
IVGIHTDEEITKHKGPPVFTEEERVKMVKGIKWVDEVVLGAPYVTTLDVL
DQNNCDFCVHGDDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTDLVGR
MLLLTRNHFRQGSAEYDIEKEVSILKRQIKSHPGSSNMGQDSAAKSPWTG
CSQFLPTTQKIIQFSDGKSPNPGDKIVYVAGAFDLFHVGHLDFLEKAKKL
GDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAPYC
VTEELLEHFKIDVVCHGRTPIALENGKIDPYAVPKTRAIFELIDSGNEMT
TERIVERIISHRLEYERRNQAKEKKEIEAFEALQRQKQTQKAG*

GH23180.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Pect-PB 393 CG5547-PB 1..393 1..393 2072 100 Plus
Pect-PD 381 CG5547-PD 1..381 1..393 1990 96.9 Plus
Pect-PC 374 CG5547-PC 1..374 1..393 1947 95.2 Plus
Pect-PE 371 CG5547-PE 1..371 1..393 1930 94.4 Plus
Cct2-PA 381 CG18330-PA 74..234 16..174 229 36.4 Plus