Clone GH23271 Report

Search the DGRC for GH23271

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:232
Well:71
Vector:pOT2
Associated Gene/Transcripttmod-RB
Protein status:GH23271.pep: gold
Preliminary Size:2365
Sequenced Size:2395

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1539 2001-01-01 Release 2 assignment
CG1539 2002-03-19 Blastp of sequenced clone
CG1539 2003-01-01 Sim4 clustering to Release 3
tmod 2008-04-29 Release 5.5 accounting
tmod 2008-08-15 Release 5.9 accounting
tmod 2008-12-18 5.12 accounting

Clone Sequence Records

GH23271.complete Sequence

2395 bp (2395 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094727

> GH23271.complete
CGCAGACCCAGTCCCAAGTCGCAAAGTCTCCAGCCGAAAGCTGCAAGTCG
CCTCAGTGCATTCATAATTGGATTTGCCATATTGCGCGCTTCATATTCCG
TGTTTCGTATTCCGTATCGATCGGACACCTCCTACGAGCTGCAAAGATAA
TAGTCCAGAATGGAGAGTGCCCTGCCGGTGGCCGAGTTTCAGCAGATAAA
GCTGCGTCCGGTGCCAAAGGTCAAACGCCGAGCCCCTCAGCCGCCAGTGA
GCCTTCGCCTGAAGCATAAAAATACTTCTGCCACCACAAAGACAACCACG
CTCACCACCCCCGCCAAACTGTATGGCAAGGATCTGAGTGAGTACGATGA
TGTGGATGTGGAGAGCCTGCTGGCCCAGCTCTCCCCCGAGGAGATAACCA
TACTGGCCAAAGAAGTGGATCCCGATGACAACTTCCTGCCGCCAGACCAG
CGCAATAGCTATGAGTGCACCAAGGAAGCCACCGGGCCTCTCAATCGCAA
GCAGCTGATCGAGCACATCAATAAGCAGGCCATCGAGACCCCGGATCAGC
CGGAGTTCGAGCCGTTCGTTCAGGGCAAGGTTCGTGGAAAGAAGTGGGTC
CCACCGCCAAGGGATGCCCGCGACATCGAGGCCGAAGAACAAATCGCCAT
TGACATGGGCGAGGAGTACGAACACGCCCTTAACGATGCCACGCAGGAGG
AGATCATCGATCTGGCCGCCATCCTCGGCTTCCACTCGATGATGAATCAG
GACCAGTACCACGCCTCCTTGCTCAACAAGGGTCAGCCCGTGGGCCTGGG
ATGGGATGGCATTACGAAATCCACTCAGCAGAAGCTCTTCCCTATGGATC
CGCCCAACAACACAGATGTGGAGGAATCCATCAAGCGGGTCAAGGACGAT
GACTCCAAGCTGATTGACCTCAACTTGAACAACATTAAGAACATCTCGGA
CGAGAAACTCGAGCAACTGTTTGCCGCACTGCCTCAGAACGAACATTTGG
AAGTCCTCTCGCTAACAAATGTGGGCCTCACCGACAAGACAGCCCTCCTG
TTAGCCGCGGCCATAGAGAAGAGCAAAACCCTGAGAGTATTAAATGTCGA
GACCAACTTTATCAGTCCGCCCGTGATTGTTAAGTTGGTGCAAGCCCTGC
TCAAGTGCCACACCATCGAGGAGTTTAGGGCCTCCAATCAGCGGTCTGCG
GTTCTGGGCAACAAGATCGAGATGGAAATCACCGACCTGGTGGAGAAGAA
CTCGTCGCTGCTGCGCCTTGGCTTGCACCTGGAGTTCAACGACGCCCGCC
ACCGAGTGGCCGCTCACCTGCAGCGCAACATCGACAGAATACGTGTGAAA
CGCCTGAACCAGCGTAAATAAAAAGACAAATACGAAATATATAGCAGCAA
CCAACCAACAACAACATGCCACCACCCAAGAACAACAATCAAGCAGAAAG
CCATCTATATGTGTGCGTGTTTCTTTGTCCGACTCTTGATTTGATAATTA
CCAATTAACAAGCAAAACCCAGCAAGAAAATCAAACCAAACCAACAACAC
CACCAGCAAACCAGAACAACAGCAACATGAGCAACCACGGCAACCAGAAC
AACAGATCTATGTCTATGTCCAAAACTCCCCCACCAACCGACCTCTGTAC
TCTGCTCCCCGACAACCAATCCAACCAACCAGCTGTGAACTAACACCGAA
GAATGATGTGCGACATGAATTGGACGTCAGCGTCGCATGGGCCATCTGAC
CAGGAACTACACCGTTGGCGTCTGGCAGTAGGATTCATCCGACTGGGACT
TGGGAGTCTACACATTTTACACCGAAAGAAATCAATAGCCTATCAATAGT
GTTGTCACATGCTTGTTGTTGCTCTCACGCAGAGAATTGTTTCATATTGT
TTTGTTCAGTGTTTGTTGCGTTCTTCAGATTGATGATTTCGGTTCGAGTT
GTGTTTGTGTTTGGATCACCACCTAAGCATAATCATTTGTTTGTTACGAG
TTAGGCGAATGTTCATTGTCACACACGCAGATCCAGGATTAACTTTCTAT
CTGGCAGCTCTAAGTAGTTATTTCCTTAAGCAAATCTTCACATTTACGCT
GCAGCTATACACACGTTTATTTTATTTTATTTTATTTACCTACCATTCTG
TCCCTTGATTATTTGTAGCCCCTAGACGGGGCGATATTTCACAATTTTTA
GTTTTAGTCGTGTTTATATCCACACATGCACACATGATACAAACACATAC
ACATAACATACATAATACTTACACACTATATATATATGATACATATATAG
CCATGGTCTCTGAAAACAATTTACTGCTATTGAATTATGAAATGCTTAAA
CATAAATTTAACTTATGGTTAAACACACAAAAAAAAAAAAAAAAA

GH23271.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-RB 2563 tmod-RB 47..2439 1..2393 11920 99.8 Plus
tmod.h 4030 tmod.h 1787..3906 274..2393 10555 99.8 Plus
tmod-RG 3194 tmod-RG 444..1510 274..1340 5335 100 Plus
tmod-RG 3194 tmod-RG 2015..3070 1338..2393 5235 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26400625..26401283 1720..2378 3280 99.8 Plus
chr3R 27901430 chr3R 26394524..26395036 427..939 2505 99.2 Plus
chr3R 27901430 chr3R 26399687..26400066 1340..1719 1855 99.2 Plus
chr3R 27901430 chr3R 26393658..26393930 1..273 1350 99.6 Plus
chr3R 27901430 chr3R 26395098..26395351 938..1191 1240 99.2 Plus
chr3R 27901430 chr3R 26394310..26394463 274..427 770 100 Plus
chr3R 27901430 chr3R 26395423..26395573 1189..1339 755 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-RB 1212 CG1539-PB 1..1212 160..1371 6060 100 Plus
tmod-RJ 1230 CG1539-PJ 133..1230 274..1371 5490 100 Plus
tmod-RI 1320 CG1539-PI 223..1320 274..1371 5490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:04:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-RB 2508 CG1539-RB 1..2378 1..2378 11890 100 Plus
tmod-RJ 2753 CG1539-RJ 519..2623 274..2378 10525 100 Plus
tmod-RI 3000 CG1539-RI 766..2870 274..2378 10525 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-PB 403 CG1539-PB 1..403 160..1368 1828 100 Plus
tmod-PA 367 CG1539-PA 15..367 310..1368 1647 100 Plus
tmod-PH 372 CG1539-PH 20..372 310..1368 1647 100 Plus
tmod-PJ 409 CG1539-PJ 57..409 310..1368 1647 100 Plus
tmod-PC 409 CG1539-PC 57..409 310..1368 1647 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30578117..30578790 1720..2393 3325 99.6 Plus
3R 32079331 3R 30572023..30572535 427..939 2565 100 Plus
3R 32079331 3R 30577179..30577558 1340..1719 1900 100 Plus
3R 32079331 3R 30571157..30571429 1..273 1365 100 Plus
3R 32079331 3R 30572597..30572850 938..1191 1270 100 Plus
3R 32079331 3R 30571809..30571962 274..427 770 100 Plus
3R 32079331 3R 30572922..30573072 1189..1339 755 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30318948..30319621 1720..2393 3325 99.5 Plus
3R 31820162 3R 30312854..30313366 427..939 2565 100 Plus
3R 31820162 3R 30318010..30318389 1340..1719 1900 100 Plus
3R 31820162 3R 30311988..30312260 1..273 1365 100 Plus
3R 31820162 3R 30313428..30313681 938..1191 1270 100 Plus
3R 31820162 3R 30312640..30312793 274..427 770 100 Plus
3R 31820162 3R 30313753..30313903 1189..1339 755 100 Plus
Blast to na_te.dros performed on 2014-11-27 04:47:17 has no hits.

GH23271.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:19:26 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26400625..26401283 1720..2378 99   Plus
chr3R 26399687..26400066 1340..1719 99 -> Plus
chr3R 26395426..26395573 1192..1339 100 -> Plus
chr3R 26395100..26395351 940..1191 99 -> Plus
chr3R 26394524..26395036 427..939 99 -> Plus
chr3R 26394310..26394462 274..426 100 -> Plus
chr3R 26393658..26393930 1..273 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:53:39 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..1212 160..1371 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:30:37 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..1212 160..1371 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:26:22 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..1212 160..1371 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:11 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..1212 160..1371 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:19:26 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..1212 160..1371 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:56:46 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..2378 1..2378 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:30:37 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..2378 1..2378 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:26:22 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..2378 1..2378 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:12 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..2378 1..2378 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:19:26 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..2378 1..2378 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:19:26 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30578117..30578775 1720..2378 100   Plus
3R 30577179..30577558 1340..1719 100 -> Plus
3R 30572925..30573072 1192..1339 100 -> Plus
3R 30572599..30572850 940..1191 100 -> Plus
3R 30572023..30572535 427..939 100 -> Plus
3R 30571809..30571961 274..426 100 -> Plus
3R 30571157..30571429 1..273 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:26:22 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26403839..26404497 1720..2378 100   Plus
arm_3R 26402901..26403280 1340..1719 100 -> Plus
arm_3R 26398647..26398794 1192..1339 100 -> Plus
arm_3R 26398321..26398572 940..1191 100 -> Plus
arm_3R 26397745..26398257 427..939 100 -> Plus
arm_3R 26397531..26397683 274..426 100 -> Plus
arm_3R 26396879..26397151 1..273 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:37:53 Download gff for GH23271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30318948..30319606 1720..2378 100   Plus
3R 30318010..30318389 1340..1719 100 -> Plus
3R 30313756..30313903 1192..1339 100 -> Plus
3R 30313430..30313681 940..1191 100 -> Plus
3R 30312854..30313366 427..939 100 -> Plus
3R 30312640..30312792 274..426 100 -> Plus
3R 30311988..30312260 1..273 100 -> Plus

GH23271.pep Sequence

Translation from 159 to 1370

> GH23271.pep
MESALPVAEFQQIKLRPVPKVKRRAPQPPVSLRLKHKNTSATTKTTTLTT
PAKLYGKDLSEYDDVDVESLLAQLSPEEITILAKEVDPDDNFLPPDQRNS
YECTKEATGPLNRKQLIEHINKQAIETPDQPEFEPFVQGKVRGKKWVPPP
RDARDIEAEEQIAIDMGEEYEHALNDATQEEIIDLAAILGFHSMMNQDQY
HASLLNKGQPVGLGWDGITKSTQQKLFPMDPPNNTDVEESIKRVKDDDSK
LIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAA
AIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLG
NKIEMEITDLVEKNSSLLRLGLHLEFNDARHRVAAHLQRNIDRIRVKRLN
QRK*

GH23271.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22912-PA 403 GF22912-PA 1..403 1..403 1982 96.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11761-PA 403 GG11761-PA 1..403 1..403 2121 99.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14162-PA 403 GH14162-PA 1..403 1..403 1909 93.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-PB 403 CG1539-PB 1..403 1..403 2053 100 Plus
tmod-PI 439 CG1539-PI 66..439 30..403 1864 98.1 Plus
tmod-PL 439 CG1539-PL 66..439 30..403 1864 98.1 Plus
tmod-PA 367 CG1539-PA 3..367 39..403 1860 100 Plus
tmod-PH 372 CG1539-PH 8..372 39..403 1860 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24865-PA 402 GI24865-PA 1..402 1..403 1943 94.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13473-PA 470 GL13473-PA 73..470 8..403 1916 95 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13696-PD 400 GA13696-PD 3..400 8..403 1912 95.2 Plus
Dpse\GA13696-PB 439 GA13696-PB 87..439 51..403 1822 96.6 Plus
Dpse\GA13696-PE 409 GA13696-PE 61..409 55..403 1795 96.6 Plus
Dpse\GA13696-PF 528 GA13696-PF 87..436 51..399 1774 95.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12892-PA 403 GM12892-PA 1..403 1..403 2125 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21531-PA 403 GD21531-PA 1..403 1..403 1953 93.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24508-PA 402 GJ24508-PA 1..402 1..403 1963 95.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14144-PA 403 GK14144-PA 1..403 1..403 1999 96.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10889-PA 403 GE10889-PA 1..403 1..403 2121 99.8 Plus

GH23271.hyp Sequence

Translation from 159 to 1370

> GH23271.hyp
MESALPVAEFQQIKLRPVPKVKRRAPQPPVSLRLKHKNTSATTKTTTLTT
PAKLYGKDLSEYDDVDVESLLAQLSPEEITILAKEVDPDDNFLPPDQRNS
YECTKEATGPLNRKQLIEHINKQAIETPDQPEFEPFVQGKVRGKKWVPPP
RDARDIEAEEQIAIDMGEEYEHALNDATQEEIIDLAAILGFHSMMNQDQY
HASLLNKGQPVGLGWDGITKSTQQKLFPMDPPNNTDVEESIKRVKDDDSK
LIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAA
AIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLG
NKIEMEITDLVEKNSSLLRLGLHLEFNDARHRVAAHLQRNIDRIRVKRLN
QRK*

GH23271.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-PB 403 CG1539-PB 1..403 1..403 2053 100 Plus
tmod-PI 439 CG1539-PI 66..439 30..403 1864 98.1 Plus
tmod-PL 439 CG1539-PL 66..439 30..403 1864 98.1 Plus
tmod-PA 367 CG1539-PA 3..367 39..403 1860 100 Plus
tmod-PH 372 CG1539-PH 8..372 39..403 1860 100 Plus