Clone GH24702 Report

Search the DGRC for GH24702

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:247
Well:2
Vector:pOT2
Associated Gene/TranscriptRab5-RC
Protein status:GH24702.pep: gold
Preliminary Size:2005
Sequenced Size:2061

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3664 2001-01-01 Release 2 assignment
CG3664 2001-09-19 Blastp of sequenced clone
CG3664 2003-01-01 Sim4 clustering to Release 3
Rab5 2008-04-29 Release 5.5 accounting
Rab5 2008-08-15 Release 5.9 accounting
Rab5 2008-12-18 5.12 accounting

Clone Sequence Records

GH24702.complete Sequence

2061 bp (2061 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060343

> GH24702.complete
CTCGTTTCGTTTCGTTTCTTGGGGCTGTTTTGGGGCACACAATTGAAAGG
AAAAAACGTAAATGCAAATGGTCAACTGGTCTCCAAGTGCCGCGTTTAGA
AGAGTGCGTAATTCGGCGGAAAGTCGAGTGCTTTTGCGTTGTTGTTTTCG
CTCACCCCTCGTAATTAATTAAGAAAGTTGTGTAAAATTTTTTCGCCCCG
TCCGCCATAGTGCGAGTGTAAGAGCGAGCGCGATAGATGGCCCTGAATTT
TGGGTGCGTTGCCCATGAGAGTGGGCGCTAGAGCGAGACGGCCGTACGAC
CTGCTCCAAGTGCAGCGTGCACAGTGGGTCGCAAGGCCTAAGATAGTTCA
CGAATCTAATTGTGAAGAGATAAAGAACACTGCAGATTCCGCATCCACAC
TCAGCAGCAATCTTAGCAGAAAGACTTACTCAGCAGAAGAGGGAGTGAGT
TGCAGTAACCGTCCGTAGAACCAAATATCAGTTGCCATCTCAGAGGAGGA
AGAGCGCATCCACATTCGCATCCGATCCAACCCGAACCGATCATGGCAAC
CACTCCACGCAGCGGCGGTGCCAGCGGCACTGGAACGGCGCAGCGGCCCA
ATGGCACCTCGCAGAACAAAAGCTGCCAATTCAAGTTGGTGCTCCTCGGC
GAGTCCGCTGTGGGCAAGTCCTCACTGGTGCTGCGCTTCGTCAAGGGACA
GTTCCACGAGTACCAGGAGAGCACGATAGGTGCGGCCTTTCTGACACAGA
CTATTTGCATAGAGGACACTGTCGTTAAGTTCGAGATCTGGGACACGGCT
GGCCAGGAGCGGTACCACAGCTTAGCTCCCATGTATTATCGAGGAGCGCA
GGCCGCTATTGTCGTCTATGATATACAGAATCAGGACAGTTTTCAGCGTG
CGAAGACCTGGGTCAAGGAACTGCATAAACAAGCCTCACCAAACATTGTC
ATTGCGCTGGCCGGCAACAAGGCAGATTTGTCAAACATTCGCGTCGTAGA
GTTCGATGAAGCGAAGCAATATGCCGAGGAGAACGGGCTGCTGTTCATGG
AAACCTCCGCCAAGACGGGCATGAATGTGAACGACATCTTCTTGGCCATT
GCCAAGAAACTACCTAAGAACGATGGCGCCAACAATCAGGGAACCAGCAT
AAGGCCGACTGGAACCGAAACAAATCGACCGACGAACAACTGCTGCAAGT
GATGTCCCTTCGTAGAAAATGAAATTTCCAACGAGAGATTTGAAAAGTTT
ATGCTGATAATTATAAATAAAAAAATTATTTAAAAATTCAACAGAATCAG
AAAGAAATACCTAAAGCCGGCTCTCGCAGGGGACGAATTTCATTTGAGAG
CCACGAAACCAATAATGATAAAGACCACATAAGAATTATAAGCATTAAAC
AAAGGAGCTCCCATTCCCAACATAAACGAAAGTTGCAATTAAAGAAAGTT
AGTTACAAATTCCCACACCCGATTTCCCCCATTACGCTCGATATCTGTCC
AAAAAATATACAAGCAAACTGACACTCACGCAATTGAGCTAAAATATCAG
TATAATTCCAACATAAACCATTTCAAATAACAACGCAAATTAATAATGAA
AACTAAACATGAGAAGAAAGCGCAGGGTTTTTGGAGATTTCATCGTGTCG
TAGAAAGTTTGAAATCGTATTGTATAAAAAAAAGAGAGAAACCCCGAAAC
CAACTAAGCGAGCAAAGAATATTTGTAAAGATTACATGTCGTGTAAGATT
CTGAGCATTAAGTAAGGGGCAGATTCCAGTTGCAGTTGTTCTCAGCAGCG
TTCCAAATAAAACAAACAAAACAAACAAACACCACAAGGAGCAAATGTTC
AGGCCAGCGGCTGAAGATCCTCGCTCGCCTCGGTTTGTGGCAATGTGTGT
GTCTCTACGGCTCCGGAGCTCGGACTCCAGATCCGGATACGGACGCGGAT
GATTCGACTCCGGGTCGCGGCGGACACGTGTGATAGTTGCAATTTATATA
AATTATATATACACATATGAAAATGAAGGAAAACGAAAACCACAAAAAAA
AAAAAAAAAAA

GH24702.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-RC 2063 Rab5-RC 1..2059 1..2059 10280 99.9 Plus
Rab5.d 1861 Rab5.d 184..1857 386..2059 8355 99.9 Plus
Rab5.i 1793 Rab5.i 116..1789 386..2059 8355 99.9 Plus
Rab5.d 1861 Rab5.d 8..183 1..176 880 100 Plus
Rab5.i 1793 Rab5.i 1..115 103..217 575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2359279..2360110 2043..1214 4045 99.6 Minus
chr2L 23010047 chr2L 2360870..2361303 814..381 2170 100 Minus
chr2L 23010047 chr2L 2364026..2364413 385..1 1845 99 Minus
chr2L 23010047 chr2L 2360346..2360514 1101..933 785 97.6 Minus
chr2L 23010047 chr2L 2360684..2360806 933..811 615 100 Minus
chr2L 23010047 chr2L 2360169..2360283 1215..1101 575 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-RI 660 CG3664-PI 1..660 543..1202 3300 100 Plus
Rab5-RH 660 CG3664-PH 1..660 543..1202 3300 100 Plus
Rab5-RG 660 CG3664-PG 1..660 543..1202 3300 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:06:28 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-RC 2491 CG3664-RC 25..2067 1..2043 10215 100 Plus
Rab5-RE 2182 CG3664-RE 100..1758 385..2043 8295 100 Plus
Rab5-RB 1871 CG3664-RB 213..1871 385..2043 8295 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-PI 219 CG3664-PI 1..219 543..1199 1132 100 Plus
Rab5-PH 219 CG3664-PH 1..219 543..1199 1132 100 Plus
Rab5-PG 219 CG3664-PG 1..219 543..1199 1132 100 Plus
Rab5-PE 219 CG3664-PE 1..219 543..1199 1132 100 Plus
Rab5-PC 219 CG3664-PC 1..219 543..1199 1132 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2359550..2360395 2059..1214 4215 99.9 Minus
2L 23513712 2L 2361157..2361590 814..381 2170 100 Minus
2L 23513712 2L 2364313..2364697 385..1 1925 100 Minus
2L 23513712 2L 2360633..2360801 1101..933 845 100 Minus
2L 23513712 2L 2360971..2361093 933..811 615 100 Minus
2L 23513712 2L 2360456..2360570 1215..1101 575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2359550..2360395 2059..1214 4215 99.8 Minus
2L 23513712 2L 2361157..2361590 814..381 2170 100 Minus
2L 23513712 2L 2364313..2364697 385..1 1925 100 Minus
2L 23513712 2L 2360633..2360801 1101..933 845 100 Minus
2L 23513712 2L 2360971..2361093 933..811 615 100 Minus
2L 23513712 2L 2360456..2360570 1215..1101 575 100 Minus
Blast to na_te.dros performed 2014-11-27 09:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6721..6982 1356..1610 143 54.9 Plus

GH24702.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:16:34 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2364026..2364413 1..385 98   Minus
chr2L 2360873..2361298 386..811 100 <- Minus
chr2L 2360685..2360805 812..932 100 <- Minus
chr2L 2360346..2360514 933..1101 97 <- Minus
chr2L 2360169..2360282 1102..1215 100 <- Minus
chr2L 2359279..2360108 1216..2043 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:55:23 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RF 1..660 543..1202 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:05:18 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RF 1..660 543..1202 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:16 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RG 1..660 543..1202 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:36:00 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RF 1..660 543..1202 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:16:34 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RG 1..660 543..1202 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:54:44 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RC 1..2043 1..2043 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:05:18 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RC 1..2043 1..2043 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:16 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RC 25..2067 1..2043 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:36:00 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RC 1..2043 1..2043 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:34 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RC 25..2067 1..2043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:16:34 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2364313..2364697 1..385 100   Minus
2L 2361160..2361585 386..811 100 <- Minus
2L 2360972..2361092 812..932 100 <- Minus
2L 2360633..2360801 933..1101 100 <- Minus
2L 2360456..2360569 1102..1215 100 <- Minus
2L 2359566..2360393 1216..2043 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:16 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2364313..2364697 1..385 100   Minus
arm_2L 2361160..2361585 386..811 100 <- Minus
arm_2L 2360972..2361092 812..932 100 <- Minus
arm_2L 2360633..2360801 933..1101 100 <- Minus
arm_2L 2360456..2360569 1102..1215 100 <- Minus
arm_2L 2359566..2360393 1216..2043 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:13:03 Download gff for GH24702.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2364313..2364697 1..385 100   Minus
2L 2361160..2361585 386..811 100 <- Minus
2L 2360972..2361092 812..932 100 <- Minus
2L 2360633..2360801 933..1101 100 <- Minus
2L 2360456..2360569 1102..1215 100 <- Minus
2L 2359566..2360393 1216..2043 100 <- Minus

GH24702.pep Sequence

Translation from 542 to 1201

> GH24702.pep
MATTPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFV
KGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYR
GAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIR
VVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQG
TSIRPTGTETNRPTNNCCK*

GH24702.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15280-PA 219 GF15280-PA 1..219 1..219 1159 97.7 Plus
Dana\GF23429-PA 208 GF23429-PA 12..207 29..218 424 40.8 Plus
Dana\GF22152-PA 225 GF22152-PA 15..169 30..183 403 48.4 Plus
Dana\GF17263-PA 205 GF17263-PA 12..205 30..218 390 40.7 Plus
Dana\GF14883-PA 239 GF14883-PA 23..199 19..193 389 41.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24527-PA 219 GG24527-PA 1..219 1..219 1181 100 Plus
Dere\GG10272-PA 208 GG10272-PA 12..207 29..218 424 40.8 Plus
Dere\GG24366-PA 214 GG24366-PA 12..214 30..219 404 42.4 Plus
Dere\GG17497-PA 222 GG17497-PA 6..168 22..183 402 46 Plus
Dere\GG14761-PA 205 GG14761-PA 12..205 30..218 390 40.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13785-PA 216 GH13785-PA 1..216 1..219 1078 93.2 Plus
Dgri\GH10191-PA 208 GH10191-PA 12..207 29..218 424 40.8 Plus
Dgri\GH12858-PA 229 GH12858-PA 5..184 21..199 418 42.8 Plus
Dgri\GH18257-PA 214 GH18257-PA 12..214 30..219 404 42.4 Plus
Dgri\GH18937-PA 205 GH18937-PA 12..205 30..218 388 40.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-PI 219 CG3664-PI 1..219 1..219 1132 100 Plus
Rab5-PH 219 CG3664-PH 1..219 1..219 1132 100 Plus
Rab5-PG 219 CG3664-PG 1..219 1..219 1132 100 Plus
Rab5-PE 219 CG3664-PE 1..219 1..219 1132 100 Plus
Rab5-PC 219 CG3664-PC 1..219 1..219 1132 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17188-PA 216 GI17188-PA 1..216 1..219 1080 93.2 Plus
Dmoj\GI14260-PA 208 GI14260-PA 12..207 29..218 421 40.3 Plus
Dmoj\GI23656-PA 214 GI23656-PA 12..214 30..219 404 42.4 Plus
Dmoj\GI14949-PA 222 GI14949-PA 2..184 15..199 403 40.9 Plus
Dmoj\GI10837-PA 205 GI10837-PA 12..205 30..218 392 40.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19400-PA 218 GL19400-PA 1..218 1..219 1143 97.7 Plus
Dper\GL18897-PA 208 GL18897-PA 12..207 29..218 424 40.8 Plus
Dper\GL21786-PA 214 GL21786-PA 12..214 30..219 404 42.4 Plus
Dper\GL27164-PA 205 GL27164-PA 12..205 30..218 399 40.2 Plus
Dper\GL16463-PA 223 GL16463-PA 14..168 30..183 398 46.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17598-PA 218 GA17598-PA 1..218 1..219 1143 97.7 Plus
Dpse\GA19714-PA 208 GA19714-PA 12..207 29..218 424 40.8 Plus
Dpse\GA19116-PA 214 GA19116-PA 12..214 30..219 404 42.4 Plus
Dpse\GA17362-PA 205 GA17362-PA 12..205 30..218 399 40.2 Plus
Dpse\GA22589-PA 224 GA22589-PA 14..168 30..183 398 46.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18235-PA 219 GM18235-PA 1..219 1..219 1181 100 Plus
Dsec\GM26307-PA 208 GM26307-PA 12..207 29..218 424 40.8 Plus
Dsec\GM15065-PA 214 GM15065-PA 12..214 30..219 404 42.4 Plus
Dsec\GM10050-PA 224 GM10050-PA 6..168 22..183 397 45.4 Plus
Dsec\GM15089-PA 205 GM15089-PA 12..205 30..218 390 40.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22841-PA 219 GD22841-PA 1..219 1..219 1181 100 Plus
Dsim\GD19397-PA 198 GD19397-PA 12..197 30..218 401 43.7 Plus
Dsim\GD19996-PA 205 GD19996-PA 12..205 30..218 390 40.7 Plus
Dsim\GD23961-PA 239 GD23961-PA 36..199 30..193 383 42.7 Plus
Dsim\GD11294-PA 213 GD11294-PA 9..211 30..217 381 40.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22226-PA 216 GJ22226-PA 1..216 1..219 1084 93.6 Plus
Dvir\GJ20647-PA 208 GJ20647-PA 12..207 29..218 424 40.8 Plus
Dvir\GJ18919-PA 229 GJ18919-PA 14..184 30..199 406 43.3 Plus
Dvir\GJ23499-PA 214 GJ23499-PA 12..214 30..219 404 42.4 Plus
Dvir\GJ14443-PA 205 GJ14443-PA 12..205 30..218 392 40.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14984-PA 220 GK14984-PA 1..219 1..219 1113 97.7 Plus
Dwil\GK21078-PA 208 GK21078-PA 12..207 29..218 421 40.3 Plus
Dwil\GK14185-PA 214 GK14185-PA 12..214 30..219 406 42.4 Plus
Dwil\GK20025-PA 230 GK20025-PA 14..168 30..183 402 47.1 Plus
Dwil\GK12772-PA 205 GK12772-PA 12..205 30..218 390 40.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15124-PA 219 GE15124-PA 1..219 1..219 1181 100 Plus
Dyak\GE12402-PA 208 GE12402-PA 12..207 29..218 424 40.8 Plus
Dyak\GE15254-PA 222 GE15254-PA 6..168 22..183 396 46 Plus
Dyak\GE25707-PA 288 GE25707-PA 83..288 27..219 395 40.8 Plus
Dyak\Rab1-PA 205 GE25003-PA 12..205 30..218 390 40.7 Plus

GH24702.hyp Sequence

Translation from 542 to 1201

> GH24702.hyp
MATTPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFV
KGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYR
GAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIR
VVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQG
TSIRPTGTETNRPTNNCCK*

GH24702.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-PI 219 CG3664-PI 1..219 1..219 1132 100 Plus
Rab5-PH 219 CG3664-PH 1..219 1..219 1132 100 Plus
Rab5-PG 219 CG3664-PG 1..219 1..219 1132 100 Plus
Rab5-PE 219 CG3664-PE 1..219 1..219 1132 100 Plus
Rab5-PC 219 CG3664-PC 1..219 1..219 1132 100 Plus