Clone GH25417 Report

Search the DGRC for GH25417

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:254
Well:17
Vector:pOT2
Associated Gene/TranscriptCG42508-RA
Protein status:GH25417.pep: gold
Sequenced Size:954

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4468 2010-12-02 CDS novel splice

Clone Sequence Records

GH25417.complete Sequence

954 bp assembled on 2011-01-12

GenBank Submission: BT125925.1

> GH25417.complete
GCGAGGAAGCACCAGGCGGAGAGCACTTCCAGGACCAACTCCAATCAAAT
GCAGTGCTGTGCAGGCTGACCGACCAACTGCTGCTATCTGGATGCAATGA
AGCCGAAGAAATCGGCCTTTGCCAATTCATCCACGGGATACGGCAGGAAC
AAGCACGGTAAAGGACACTCTGGCAAGGATAAAGTCGAGGGTGGTGGTAA
GGGCAAGAGCCGAGACGAGAAGGATAAGCATAAGCATGAGCAGAAGGTGG
ACGAGAAGGATGACAAGGATCTAAATTCCGGCTTCGGCGACTATCTTCGC
ACTCCGGAGGGTCTCATTTGAAATGATGAAACTCTTTGTCTTCGCCAATA
CCATAATGCTAATTGTCACCATGGCCTGGCCGCACATCAAGGAGCAATTC
TACATGGTTAATCAATGGCTTGAAAGCTTCCGCGAGGAGCATCAGCAGTA
GAAACCAAAGGATCTATCGAACAAATAAGTAAATCAAGTGGAAGCATACA
ATATGGTCGGTCCATTCATGCAGGGCCTATTCTTGATTGGCATCATCTAC
TGGTATTCCAAGGGGATGATGTCCATGATCAACGACTACTACAGAAGTGA
GTTCCAGCGAAAGTTGCAGACGGAACCAGCAAAGACGAGGGCAGAGACAC
CCATCAATGTGGACAACTTTATGGATTATGTTAGGGAGCTGGACACTCCG
GACGAGGTGGCTAGAATTCCGGCGGAAGGAACTGAATCTCCGCCCATGGG
AAACACCTATTGCCACATCCTTCGACGATTCTTGGAGATTACCGGCACTC
TACCACCATTCGATGTTTGCCTAGTTACGAGCAACATAAGATAGCCCATC
CTATAATTAATTATATATGGTATCAATTATACTTAGTGTGTTTTATATGA
GTTTCGTAGAATAAAATATCTTACTAACCGTATTGCAAAAAAAAAAAAAA
AAAA

GH25417.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15738309..15738926 932..315 2985 98.9 Minus
chr3R 27901430 chr3R 15738991..15739304 314..1 1555 99.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-RB 342 CG42508-PB 1..342 503..844 1710 100 Plus
CG42508-RA 342 CG42508-PA 1..342 503..844 1710 100 Plus
Xport-RA 351 CG4468-PA 1..351 97..451 1680 98.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-RB 1029 CG42508-RB 23..958 1..936 4680 100 Plus
CG42508-RA 949 CG42508-RA 23..949 1..931 4560 99.6 Plus
Xport-RA 949 CG4468-RA 23..949 1..931 4560 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-PB 113 CG42508-PB 1..113 503..841 604 100 Plus
CG42508-PA 113 CG42508-PA 1..113 503..841 604 100 Plus
Xport-PA 116 CG4468-PA 1..71 97..309 310 100 Plus
Xport-PA 116 CG4468-PA 72..116 314..448 238 97.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19914390..19915012 937..315 3115 100 Minus
3R 32079331 3R 19915077..19915390 314..1 1570 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19655221..19655843 937..315 3115 100 Minus
3R 31820162 3R 19655908..19656221 314..1 1570 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:55:50 has no hits.

GH25417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 18:01:00 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15738991..15739304 1..314 99   Minus
chr3R 15738306..15738926 315..936 98 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-14 09:32:53 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
CG42508-RA 1..342 503..844 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:41:54 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
CG42508-RA 1..342 503..844 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:01:00 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
CG42508-RA 1..342 503..844 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-14 09:32:52 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
CG4468-RA 20..946 1..931 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:41:54 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
Xport-RB 1..936 1..936 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:01:00 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
CG42508-RB 23..958 1..936 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 18:01:00 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19915077..19915390 1..314 100   Minus
3R 19914391..19915012 315..936 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:41:54 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15740799..15741112 1..314 100   Minus
arm_3R 15740113..15740734 315..936 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:55:35 Download gff for GH25417.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19655908..19656221 1..314 100   Minus
3R 19655222..19655843 315..936 100 <- Minus

GH25417.pep Sequence

Translation from 502 to 843

> GH25417.pep
MVGPFMQGLFLIGIIYWYSKGMMSMINDYYRSEFQRKLQTEPAKTRAETP
INVDNFMDYVRELDTPDEVARIPAEGTESPPMGNTYCHILRRFLEITGTL
PPFDVCLVTSNIR*

GH25417.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17349-PA 114 GF17349-PA 1..114 1..113 439 72.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15753-PA 115 GG15753-PA 1..115 1..113 512 84.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23288-PA 121 GH23288-PA 1..109 1..106 310 55 Plus
Dgri\GH19616-PA 121 GH19616-PA 1..109 1..106 305 55.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-PB 113 CG42508-PB 1..113 1..113 604 100 Plus
CG42508-PA 113 CG42508-PA 1..113 1..113 604 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10325-PA 117 GI10325-PA 1..109 1..106 303 60.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12529-PA 114 GL12529-PA 1..112 1..110 387 67.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27541-PA 114 GA27541-PA 1..112 1..110 384 67.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26885-PA 113 GM26885-PA 1..113 1..113 555 91.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20093-PA 113 GD20093-PA 1..113 1..113 563 92.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10180-PA 117 GJ10180-PA 1..109 1..106 314 58.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25103-PA 111 GE25103-PA 1..111 1..113 484 81.4 Plus

GH25417.hyp Sequence

Translation from 502 to 843

> GH25417.hyp
MVGPFMQGLFLIGIIYWYSKGMMSMINDYYRSEFQRKLQTEPAKTRAETP
INVDNFMDYVRELDTPDEVARIPAEGTESPPMGNTYCHILRRFLEITGTL
PPFDVCLVTSNIR*

GH25417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-PB 113 CG42508-PB 1..113 1..113 604 100 Plus
CG42508-PA 113 CG42508-PA 1..113 1..113 604 100 Plus