Clone GH25564 Report

Search the DGRC for GH25564

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:255
Well:64
Vector:pOT2
Associated Gene/TranscriptCG5641-RA
Protein status:GH25564.pep: gold
Preliminary Size:1623
Sequenced Size:1372

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5641 2001-01-01 Release 2 assignment
CG5641 2001-07-04 Blastp of sequenced clone
CG5641 2003-01-01 Sim4 clustering to Release 3
CG5641 2008-04-29 Release 5.5 accounting
CG5641 2008-08-15 Release 5.9 accounting
CG5641 2008-12-18 5.12 accounting

Clone Sequence Records

GH25564.complete Sequence

1372 bp (1372 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051610

> GH25564.complete
TTAAAAAAAACAGAACGCTCCGGCGTTGCGAAAATTATTAAAAATTCATC
CCCACAGGAATATGGTTCGCGGAGCTCTCCGAGGTGGCCGCCCCATGCGC
GGCGGCATACGTCCGCCGTTCAAAAAGACATTCGTGCCGCGCCACCCCTT
CGATCTGACCCTCGCGGAGGTCTTCTTTCCCAAAGTTCCATCCGCCGGCG
CCGTTGACGATTCTGCTTTGACTGCGGCGCTGCTGAAGCGTAACCAGGAC
CTGAGTCCCACTCCCAGCGAGCAGACGGCTATTGGCAATCTAGTGACCAA
GGTGCAGGCTGTTCTCGACAATCTGGTGGTTGCACCCGGGGATCTGACAA
CTTGTCAACTGGAGGAAGTGCGTCAGGTTGGCTCCTTCAAGAAGGGCACC
ATACTGACGGGCAACAATGTAGCCGATGTGGTGGTTATCCTCAAAACCCT
GCCCACCAAGGAGGCCGTCGATGCGCTGGCCAAAAAAGTGGAGGCCGACC
TGAAGGCCAGCATGAAGACTGAAGTTCTGACCAAGGGCGATCAGCACACC
GTACAGATCCATGAGCGGGGCTTCGACATCGCCAACGTGCATGCCAAGGT
GCGCATTCTGATCGCCACCTTGCCGCAGAATCTTCGCAAGCTGGAGCCTG
AGATCCATTTGGATCACAAACTGATGCAGAGCCATCTGGCTGCCATTCGG
CACACGCGCTGGTTTGAGGAAAATGCCCACCACTCCTCGATAAAGGTGCT
CATTCGCATTCTCAAGGATCTCACTAGGCGTTTCGACGCTTTTTCGCCGC
TGTCGGCCTGGATGCTGGACCTGATCGCCCATTTGGCCATCATGAACAAC
CCGTCGCGACAGGCACTGCCCATCAACCTGGCCTTCCGTCGCGTCTTTCA
GCTACTCTCCGCCGGGCTCTTCCTGCCGGGCTCGGCCGGCATCACGGATC
CCACCGAGCCGGGACACATCCGTGTGCACACTGCCATGACATTGGAGCAG
CAGGATGTGTGCTGCTACACATCGCAGACACTACTGCGCGTGCTGGCCCA
CGGCGGATACAAACACATTTTGGGACTGGAGGGCAACACCAGCGTTGTGC
GCGAAATGTCCGTCTGGAACGGCGTGTGCATTTCCCCGCTGACCGCTGTC
TACGAGAAGCCAACGGACAAGAAGGAGGGCGACCTCGAGGAGGACATCGA
CATGATCGAGAATGAGAACGAAGAAGAGGGCAGCGACGATGGCGCCGAGT
AATACAGACCAAGCTATTCATTTACAAGTGTATTTAAATTCCCAACCCAT
GATTCAATTGATTATACTATTCCCAAGTATGGGTTCATCCTCACCAAAAA
AAAAAAAAAAAAAAAAAAAAAA

GH25564.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-RA 1421 CG5641-RA 66..1412 1..1347 6735 100 Plus
DmSAS-RA 1226 DmSAS-RA 1110..1226 1347..1231 585 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8253183..8254172 1345..356 4935 99.9 Minus
chr3R 27901430 chr3R 8254424..8254650 227..1 1135 100 Minus
chr3R 27901430 chr3R 8254234..8254363 355..226 650 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-RA 1191 CG5641-PA 1..1191 62..1252 5955 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:07:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-RA 1365 CG5641-RA 21..1365 1..1345 6725 100 Plus
Sas-RA 1194 CG5232-RA 1112..1194 1345..1263 415 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-PA 396 CG5641-PA 1..373 62..1180 1824 100 Plus
Zn72D-PD 884 CG5215-PD 545..836 245..1117 194 25.7 Plus
Zn72D-PC 884 CG5215-PC 545..836 245..1117 194 25.7 Plus
Zn72D-PF 884 CG5215-PF 545..836 245..1117 194 25.7 Plus
Zn72D-PB 884 CG5215-PB 545..836 245..1117 194 25.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12427793..12428784 1347..356 4960 100 Minus
3R 32079331 3R 12429036..12429262 227..1 1135 100 Minus
3R 32079331 3R 12428846..12428975 355..226 650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12168624..12169615 1347..356 4960 100 Minus
3R 31820162 3R 12169867..12170093 227..1 1135 100 Minus
3R 31820162 3R 12169677..12169806 355..226 650 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:17:27 has no hits.

GH25564.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:06:22 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8254425..8254650 1..226 100   Minus
chr3R 8254234..8254362 227..355 100 <- Minus
chr3R 8253183..8254172 356..1345 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:06 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 1..1191 62..1252 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:23:47 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 1..1191 62..1252 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:00:40 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 1..1191 62..1252 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:56:36 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 1..1191 62..1252 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:06:22 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 1..1191 62..1252 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:21:35 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 19..1363 1..1345 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:23:47 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 19..1363 1..1345 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:00:40 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 21..1365 1..1345 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:56:36 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 19..1363 1..1345 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:06:22 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 21..1365 1..1345 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:06:22 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12429037..12429262 1..226 100   Minus
3R 12428846..12428974 227..355 100 <- Minus
3R 12427795..12428784 356..1345 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:00:40 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8254759..8254984 1..226 100   Minus
arm_3R 8254568..8254696 227..355 100 <- Minus
arm_3R 8253517..8254506 356..1345 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:34:20 Download gff for GH25564.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12169868..12170093 1..226 100   Minus
3R 12169677..12169805 227..355 100 <- Minus
3R 12168626..12169615 356..1345 100 <- Minus

GH25564.pep Sequence

Translation from 61 to 1251

> GH25564.pep
MVRGALRGGRPMRGGIRPPFKKTFVPRHPFDLTLAEVFFPKVPSAGAVDD
SALTAALLKRNQDLSPTPSEQTAIGNLVTKVQAVLDNLVVAPGDLTTCQL
EEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALAKKVEADLKAS
MKTEVLTKGDQHTVQIHERGFDIANVHAKVRILIATLPQNLRKLEPEIHL
DHKLMQSHLAAIRHTRWFEENAHHSSIKVLIRILKDLTRRFDAFSPLSAW
MLDLIAHLAIMNNPSRQALPINLAFRRVFQLLSAGLFLPGSAGITDPTEP
GHIRVHTAMTLEQQDVCCYTSQTLLRVLAHGGYKHILGLEGNTSVVREMS
VWNGVCISPLTAVYEKPTDKKEGDLEEDIDMIENENEEEGSDDGAE*

GH25564.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17043-PA 396 GF17043-PA 1..396 1..396 2047 95.2 Plus
Dana\GF10657-PA 883 GF10657-PA 557..840 68..352 182 25 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17126-PA 396 GG17126-PA 1..396 1..396 2084 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17463-PA 394 GH17463-PA 1..394 1..396 1941 90.9 Plus
Dgri\GH14705-PA 923 GH14705-PA 734..875 209..352 155 28.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-PA 396 CG5641-PA 1..396 1..396 2030 100 Plus
Zn72D-PD 884 CG5215-PD 545..836 62..352 194 25.7 Plus
Zn72D-PC 884 CG5215-PC 545..836 62..352 194 25.7 Plus
Zn72D-PF 884 CG5215-PF 545..836 62..352 194 25.7 Plus
Zn72D-PB 884 CG5215-PB 545..836 62..352 194 25.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22787-PA 394 GI22787-PA 1..394 1..396 1895 88.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27175-PA 383 GL27175-PA 1..383 12..396 1902 91.9 Plus
Dper\GL25096-PA 915 GL25096-PA 605..856 100..340 173 25.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19024-PA 383 GA19024-PA 1..383 12..396 1902 91.9 Plus
Dpse\GA18742-PA 915 GA18742-PA 605..856 100..340 173 25.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26008-PA 396 GM26008-PA 1..396 1..396 2089 99 Plus
Dsec\GM24445-PA 884 GM24445-PA 545..836 62..352 186 25.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20566-PA 396 GD20566-PA 1..396 1..396 2090 99 Plus
Dsim\GD12514-PA 884 GD12514-PA 545..836 62..352 186 25.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22789-PA 394 GJ22789-PA 1..394 1..396 1948 91.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12843-PA 397 GK12843-PA 1..397 1..396 1825 89.5 Plus
Dwil\GK23905-PA 948 GK23905-PA 600..889 68..352 151 23.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24517-PA 371 GE24517-PA 1..371 1..396 1911 92.4 Plus
Dyak\GE19795-PA 1057 GE19795-PA 718..1009 62..352 182 25.2 Plus

GH25564.hyp Sequence

Translation from 61 to 1251

> GH25564.hyp
MVRGALRGGRPMRGGIRPPFKKTFVPRHPFDLTLAEVFFPKVPSAGAVDD
SALTAALLKRNQDLSPTPSEQTAIGNLVTKVQAVLDNLVVAPGDLTTCQL
EEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALAKKVEADLKAS
MKTEVLTKGDQHTVQIHERGFDIANVHAKVRILIATLPQNLRKLEPEIHL
DHKLMQSHLAAIRHTRWFEENAHHSSIKVLIRILKDLTRRFDAFSPLSAW
MLDLIAHLAIMNNPSRQALPINLAFRRVFQLLSAGLFLPGSAGITDPTEP
GHIRVHTAMTLEQQDVCCYTSQTLLRVLAHGGYKHILGLEGNTSVVREMS
VWNGVCISPLTAVYEKPTDKKEGDLEEDIDMIENENEEEGSDDGAE*

GH25564.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-PA 396 CG5641-PA 1..396 1..396 2030 100 Plus
Zn72D-PD 884 CG5215-PD 545..836 62..352 194 25.7 Plus
Zn72D-PC 884 CG5215-PC 545..836 62..352 194 25.7 Plus
Zn72D-PF 884 CG5215-PF 545..836 62..352 194 25.7 Plus
Zn72D-PB 884 CG5215-PB 545..836 62..352 194 25.7 Plus