Clone GH26463 Report

Search the DGRC for GH26463

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:264
Well:63
Vector:pOT2
Associated Gene/TranscriptPask-RA
Protein status:GH26463.pep: gold
Preliminary Size:3039
Sequenced Size:3190

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3105 2001-01-01 Release 2 assignment
CG3105 2001-10-10 Blastp of sequenced clone
CG3105 2003-01-01 Sim4 clustering to Release 3
CG3105 2008-04-29 Release 5.5 accounting
CG3105 2008-08-15 Release 5.9 accounting
CG3105 2008-12-18 5.12 accounting

Clone Sequence Records

GH26463.complete Sequence

3190 bp (3190 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060800

> GH26463.complete
TGTTTACGGTGCGCTCATTTGGTTGTAGCTGTAGGCCTCGAGTTGGAACC
GCTGGGACTTGGAAAACATACGACGCTTAAATGGAGGATCAGGGCGACGT
GACAGACCAAGCCGCTGGTAAGCTGAGTAGTTCGAATGCCCAGTGCTCCA
GAAACCGATGTGCTAATGATGACCCCATTATGGGCAGCCACAGTCAGAGT
CGCCAGAACTCGTCCGGCATGCTGAACATGATGGACGCCAGCTCCTTCAG
CATGCCCCCCCCCAATCTGCACTCCTCAAAGGTGATCAACCCGAACAAGG
CGATATTCACAATCGACGCGAACACAGGGCAAATTTTTATAGTGAACAAC
AAGGCCTGCCAGCTGCTGGGCTACACGTCGCAGGAGTTGAGGAACAAGGG
ATTCTTCGACCTGCTTAACGGCAAGACAGAGAGCCACATCTCCTCCCTGG
CGGAGATGCAGATCGAAGGCGATGAGGGCCGGGTCGTCCTGCTAAGTGGA
AAGGTCATCGAGATGAAGACCAAGTCGGGCGGCAAGATCCTGGTCTCTCT
CTGGATCCGGCAGATCAGCAGCGATGGCCGACACATAGCCGTCGCGGAGC
CTGTGGAGAGGCATATTTGCCACATCAGCACCGATAGATCCGGAGTGATA
ACATCCGTTGACTCCACCACGGCCACCATATTCTTTTATGAATCCGTCGA
AAGCGTGGTGGGTGTCAGCATTGTCACCCTTATCCCGTTTATAAAGCTGC
CCGATCCGGATAGCCGTGAGATCCCCAAGAGCCTGCGGAAGCAGAGAGCT
ACTGGTCGAACTACGGATAACGTAAAGTTTCCCCTGTGCTTGCTAATAGC
CCTGGACGAGGATGCTTCTGCGGGGTATTCCCATTCGGGAAAAACCGGTC
TAAATATCACCGTCTGGGTGTTCCAGAATCTTAGTGGCCTGATTGTGGTA
GATGACATAGGCAACATACTGATGTGCAACCAGCCTTTCTCGCTGCTAAT
GTTCGGATATGGTCAGGACAAGATAATGAACATGCATATATCGGCGATCC
TACCCAATTTCGGCAAGGACTCTCGCGAGGAGAAGAGTCCGAATGTTTCG
AACACCTCGATAACCAGTAACGACTGGGAGCCGGACACGGATCCCCTCGT
CGTGGACAACGACTCCTCGCTGCAATCCTGCAAGAAGAGCTCGACTAACA
GGACGGCGCCCAACAACGAACAGTCTTCGGTGGGCGATGCCCACCTAAGC
TGCAATCTGGAGAACAGCAGTGGTCTATTCTGCGACCTCCGCCAGCCAGA
TGATTGTACAATAGATGACATTCTAACACCTGTAAATGCCTCAAACAGTT
TCCCCGCTGACGAGTTTGAGGTAGGATCGCAGTCGCAGGTGAATGAGTCG
TCCCTTGACAAGGCGAAGTCCGCGTCCACGGAGACCTGTGATGCCTCCGG
CAGCAATCCCGCCACCAGACTGCTTAGTTCCATCAACGGAAGCTTTGTGG
GGGAGGCCATTCACGCCGATGGCTCCGTCATAGAGGTAGTCTACTCCGTG
CTCCTCCAGATACTGCCCTGCTCCAACCGGGTGTACTGCATCTGGGTGTG
CCGCAACCCCAGCACTCGGCTGGACGGTGAGAAGTACAACTATGCAAACC
TAACGTCCACATTCAACAGCATGGCCAGCACTGTTGAGCAGTCGCTGGGC
CAGGTGATAAAGACCACCGCTGCCCAGAACTCCAGCAGACCCAATTCTCT
GTCCTTGGTGTCCAAGTACGAGGACGAATTGTACCTGGGCGACTACAGCA
AATACTACACGTCCATCCGCCAGATCGGAAGAGGAGCCTATGGGTATGTG
AATATGGCTTTCCGGAACAGCGACCGCCTGCTGGTGATCACCAAGTTTAT
TCTCAAGGAGAAGCTCTGCTCTCAGTTTATGGTTAAGAGCCGCGACTGCA
AGGAAGTTCCTATCGAGATCCACCTGCTGCAGACCCTGAACCACAAGAAC
ATTGTGTCCGTTCTCGATGTTTTCGAAAATGATCTATTCTACCAGCTGGT
CATGGAGAAGCACGGATCCGGAATGGATCTATGGACGTTCATAGAGCGGC
GGCCCCTGATGGACGAAAAGCTGGGAAGCTACATTTTTCGTCAGGTGGCC
GATGCCGTCAACTATCTGCACGAACAGAAGATACTGCATCGGGACATCAA
GGACGAGAACATTATAATTGACCAGAACTTCACCATAAAGCTGATTGACT
TCGGATCGGCGACCTTCATGGAGGAGGGAAAATTCTTCTCCACGTTCTAC
GGCACGACGGAGTACTGCAGTCCGGAGGTTCTGGCCGGAAACAGATACGT
GGGTCCCGAGCTGGAGATTTGGGCCCTTGGTGTGACGCTTTACGTTCTGA
TGTTTTTCGAAAATCCATTCATCGATGTGGAGGAGACATTGAAGGCCGAG
ATTCAAATACCGAAAGCTGTGTCCGAGCAATTGAGCCGTCTGTTGAGCTC
CATGCTGAATAAGGATCCCAAGTACCGGTGCACCATGCACCAGTTAATCA
CAGATCCATGGCTCACCCAGGAGGTGAATCCCTCTACTTTCAGTTTCTCG
TGGATAGTGCCGTGCAAGGCCCACGAGGCCAATCCGAATCTGTATTTTTC
CGGCTACCTATACTCCAGTACTTCGGTGCTGTCCACTATTTCACCGCAGG
AGAGCTTCTCCCACATCGAGGAGTCCTCGATTGGGGGCAGCGATGACGCC
AGATTAGCATCCCACAGAACCGGACACAAGTTGTGCGTTAATGAAGCCAA
GCACAACAAAATGGACACTCTTTACGCGAAACAGTTCCAGCTAAACACCT
CAGTGAGTAACCACGAGCTGAGGGTCTCGTTACCTGACTCAAGCCACACA
GAAATCGGCGGTTCAATATGCTCCTCGAAATCCGAGAACGATATATTCAA
GAACAAGCTTCAGCCCTGCGTCTCCACTTATAACGTAGTTAGTCTGCACG
ACGTGAGCACGAAACCCAAGAAGCTTGATCTGAAATGAAGTTCGAAATCC
GTTGTGTACATGTGTAAATCGAATCTGAGCATACTGTCATATGTAAATAG
CAACATTTGTGAAAGGACAATTAAGTATTGGGGCGGAAAAGCATGTAGAT
GAATAAATCAATTTAATTGTTAAAAAAAAAAAAAAAAAAA

GH26463.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG3105-RA 3296 CG3105-RA 125..3296 1..3172 15860 100 Plus
CG3105.a 3155 CG3105.a 150..3155 167..3172 15030 100 Plus
CG3105.a 3155 CG3105.a 35..151 1..117 585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19875066..19877694 168..2796 12920 99.4 Plus
chr2R 21145070 chr2R 19877753..19878129 2795..3171 1870 99.7 Plus
chr2R 21145070 chr2R 19874831..19874998 1..168 840 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-RA 2958 CG3105-PA 1..2958 81..3038 14790 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:09:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-RA 3184 CG3105-RA 14..3184 1..3171 15855 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-PA 985 CG3105-PA 1..975 81..3005 4983 100 Plus
CG43143-PD 1180 CG11870-PD 73..328 1815..2585 376 32.7 Plus
CG43143-PG 1199 CG43143-PG 73..328 1815..2585 376 32.7 Plus
CG43143-PB 1427 CG11870-PB 73..328 1815..2585 376 32.7 Plus
CG43143-PC 1427 CG11870-PC 73..328 1815..2585 376 32.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23988986..23991614 168..2796 13145 100 Plus
2R 25286936 2R 23991673..23992050 2795..3172 1890 100 Plus
2R 25286936 2R 23988751..23988918 1..168 840 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23990185..23992813 168..2796 13145 100 Plus
2R 25260384 2R 23992872..23993249 2795..3172 1890 100 Plus
2R 25260384 2R 23989950..23990117 1..168 840 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:45:33 has no hits.

GH26463.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:39:46 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19877755..19878129 2797..3171 99   Plus
chr2R 19875067..19877694 169..2796 99 -> Plus
chr2R 19874831..19874998 1..168 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:57:26 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3105-RA 1..2958 81..3038 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:36:04 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 1..2958 81..3038 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:02:25 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 1..2958 81..3038 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:04:56 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3105-RA 1..2958 81..3038 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:46 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 1..2958 81..3038 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:16:12 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3105-RA 35..3205 1..3171 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:36:04 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 35..3205 1..3171 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:02:25 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 14..3184 1..3171 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:04:57 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3105-RA 35..3205 1..3171 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:46 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 14..3184 1..3171 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:39:46 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23991675..23992049 2797..3171 100   Plus
2R 23988987..23991614 169..2796 100 -> Plus
2R 23988751..23988918 1..168 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:02:25 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19879198..19879572 2797..3171 100   Plus
arm_2R 19876510..19879137 169..2796 100 -> Plus
arm_2R 19876274..19876441 1..168 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:40:47 Download gff for GH26463.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23992892..23993266 2797..3171 100   Plus
2R 23990204..23992831 169..2796 100 -> Plus
2R 23989968..23990135 1..168 100 -> Plus

GH26463.pep Sequence

Translation from 80 to 3037

> GH26463.pep
MEDQGDVTDQAAGKLSSSNAQCSRNRCANDDPIMGSHSQSRQNSSGMLNM
MDASSFSMPPPNLHSSKVINPNKAIFTIDANTGQIFIVNNKACQLLGYTS
QELRNKGFFDLLNGKTESHISSLAEMQIEGDEGRVVLLSGKVIEMKTKSG
GKILVSLWIRQISSDGRHIAVAEPVERHICHISTDRSGVITSVDSTTATI
FFYESVESVVGVSIVTLIPFIKLPDPDSREIPKSLRKQRATGRTTDNVKF
PLCLLIALDEDASAGYSHSGKTGLNITVWVFQNLSGLIVVDDIGNILMCN
QPFSLLMFGYGQDKIMNMHISAILPNFGKDSREEKSPNVSNTSITSNDWE
PDTDPLVVDNDSSLQSCKKSSTNRTAPNNEQSSVGDAHLSCNLENSSGLF
CDLRQPDDCTIDDILTPVNASNSFPADEFEVGSQSQVNESSLDKAKSAST
ETCDASGSNPATRLLSSINGSFVGEAIHADGSVIEVVYSVLLQILPCSNR
VYCIWVCRNPSTRLDGEKYNYANLTSTFNSMASTVEQSLGQVIKTTAAQN
SSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRL
LVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFEN
DLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQK
ILHRDIKDENIIIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEV
LAGNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQ
LSRLLSSMLNKDPKYRCTMHQLITDPWLTQEVNPSTFSFSWIVPCKAHEA
NPNLYFSGYLYSSTSVLSTISPQESFSHIEESSIGGSDDARLASHRTGHK
LCVNEAKHNKMDTLYAKQFQLNTSVSNHELRVSLPDSSHTEIGGSICSSK
SENDIFKNKLQPCVSTYNVVSLHDVSTKPKKLDLK*

GH26463.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12888-PA 952 GF12888-PA 13..952 31..985 4246 83 Plus
Dana\GF17461-PA 1591 GF17461-PA 73..326 579..833 410 33.3 Plus
Dana\GF11717-PA 1419 GF11717-PA 487..738 576..828 377 31.7 Plus
Dana\GF21982-PA 1480 GF21982-PA 139..395 575..832 375 31.1 Plus
Dana\GF10369-PA 863 GF10369-PA 18..270 576..829 370 30 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22919-PA 985 GG22919-PA 1..985 1..985 5132 97.5 Plus
Dere\GG17493-PA 1550 GG17493-PA 73..326 579..833 393 32.6 Plus
Dere\GG21978-PA 1223 GG21978-PA 464..747 542..828 383 31.6 Plus
Dere\GG17228-PA 585 GG17228-PA 63..314 576..828 374 32.8 Plus
Dere\GG13513-PA 861 GG13513-PA 18..270 576..829 371 30 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19123-PA 1414 GH19123-PA 79..332 579..833 396 33 Plus
Dgri\GH20210-PA 1146 GH20210-PA 487..738 576..828 389 32.4 Plus
Dgri\GH20038-PA 719 GH20038-PA 33..286 575..829 363 32.4 Plus
Dgri\GH14360-PA 865 GH14360-PA 18..270 576..829 363 29.6 Plus
Dgri\GH12117-PA 589 GH12117-PA 34..292 582..840 358 31.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-PA 985 CG3105-PA 1..985 1..985 5097 100 Plus
CG43143-PD 1180 CG11870-PD 73..328 579..835 376 32.7 Plus
CG43143-PG 1199 CG43143-PG 73..328 579..835 376 32.7 Plus
CG43143-PB 1427 CG11870-PB 73..328 579..835 376 32.7 Plus
CG43143-PC 1427 CG11870-PC 73..328 579..835 376 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23579-PA 1495 GI23579-PA 72..325 579..833 395 32.6 Plus
Dmoj\GI20735-PA 1228 GI20735-PA 500..751 576..828 375 31.7 Plus
Dmoj\GI10063-PA 766 GI10063-PA 125..382 570..828 367 29.8 Plus
Dmoj\GI15425-PA 1432 GI15425-PA 143..399 575..832 359 29.8 Plus
Dmoj\GI16329-PA 589 GI16329-PA 40..298 582..840 357 31.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11648-PA 864 GL11648-PA 1..864 126..985 3608 78.5 Plus
Dper\GL23688-PA 1597 GL23688-PA 78..331 579..833 410 33.3 Plus
Dper\GL10531-PA 1212 GL10531-PA 484..735 576..828 375 31.7 Plus
Dper\GL12610-PA 733 GL12610-PA 118..375 570..828 364 30.2 Plus
Dper\GL15126-PA 1366 GL15126-PA 143..399 575..832 361 30.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15966-PA 864 GA15966-PA 1..864 126..985 3618 78.7 Plus
Dpse\GA26704-PB 1439 GA26704-PB 78..331 579..833 408 33.3 Plus
Dpse\GA26704-PC 1033 GA26704-PC 78..331 579..833 407 33.3 Plus
Dpse\GA22494-PA 1468 GA22494-PA 78..331 579..833 403 33 Plus
Dpse\GA24400-PA 1212 GA24400-PA 484..735 576..828 376 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16079-PA 967 GM16079-PA 1..967 1..985 5092 96.5 Plus
Dsec\GM23873-PA 1565 GM23873-PA 57..322 567..833 404 31.5 Plus
Dsec\GM21966-PA 1192 GM21966-PA 470..721 576..828 376 31.7 Plus
Dsec\GM26105-PA 603 GM26105-PA 57..314 570..828 369 30.9 Plus
Dsec\GM26104-PA 705 GM26104-PA 92..349 570..828 368 30.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11820-PA 985 GD11820-PA 1..985 1..985 5234 98.6 Plus
Dsim\GD18682-PA 1567 GD18682-PA 57..322 567..833 403 31.5 Plus
Dsim\GD20665-PA 603 GD20665-PA 57..314 570..828 373 30.6 Plus
Dsim\GD12530-PA 680 GD12530-PA 124..376 576..829 373 30 Plus
Dsim\GD16554-PA 582 GD16554-PA 34..292 582..840 346 31 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23554-PA 1365 GJ23554-PA 72..325 579..833 404 33 Plus
Dvir\GJ20472-PA 1208 GJ20472-PA 480..731 576..828 375 31.7 Plus
Dvir\GJ14109-PA 857 GJ14109-PA 18..270 576..829 364 29.6 Plus
Dvir\GJ23798-PA 756 GJ23798-PA 124..381 570..828 362 29.8 Plus
Dvir\GJ16386-PA 1350 GJ16386-PA 119..375 575..832 362 30.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10638-PA 971 GK10638-PA 1..932 51..978 3511 70.8 Plus
Dwil\GK12830-PA 2853 GK12830-PA 81..334 579..833 403 33 Plus
Dwil\GK11799-PA 719 GK11799-PA 109..366 570..828 381 30.9 Plus
Dwil\GK15874-PA 1239 GK15874-PA 512..763 576..828 377 31.7 Plus
Dwil\GK20597-PA 874 GK20597-PA 18..270 576..829 371 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14356-PA 985 GE14356-PA 1..985 1..985 5166 97.1 Plus
Dyak\GE26024-PA 1476 GE26024-PA 78..331 579..833 396 32.6 Plus
Dyak\GE12057-PA 1211 GE12057-PA 483..734 576..828 376 31.7 Plus
Dyak\GE23131-PA 861 GE23131-PA 18..270 576..829 371 30 Plus
Dyak\GE24628-PA 600 GE24628-PA 57..314 570..828 370 32.1 Plus

GH26463.hyp Sequence

Translation from 80 to 3037

> GH26463.hyp
MEDQGDVTDQAAGKLSSSNAQCSRNRCANDDPIMGSHSQSRQNSSGMLNM
MDASSFSMPPPNLHSSKVINPNKAIFTIDANTGQIFIVNNKACQLLGYTS
QELRNKGFFDLLNGKTESHISSLAEMQIEGDEGRVVLLSGKVIEMKTKSG
GKILVSLWIRQISSDGRHIAVAEPVERHICHISTDRSGVITSVDSTTATI
FFYESVESVVGVSIVTLIPFIKLPDPDSREIPKSLRKQRATGRTTDNVKF
PLCLLIALDEDASAGYSHSGKTGLNITVWVFQNLSGLIVVDDIGNILMCN
QPFSLLMFGYGQDKIMNMHISAILPNFGKDSREEKSPNVSNTSITSNDWE
PDTDPLVVDNDSSLQSCKKSSTNRTAPNNEQSSVGDAHLSCNLENSSGLF
CDLRQPDDCTIDDILTPVNASNSFPADEFEVGSQSQVNESSLDKAKSAST
ETCDASGSNPATRLLSSINGSFVGEAIHADGSVIEVVYSVLLQILPCSNR
VYCIWVCRNPSTRLDGEKYNYANLTSTFNSMASTVEQSLGQVIKTTAAQN
SSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRL
LVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFEN
DLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQK
ILHRDIKDENIIIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEV
LAGNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQ
LSRLLSSMLNKDPKYRCTMHQLITDPWLTQEVNPSTFSFSWIVPCKAHEA
NPNLYFSGYLYSSTSVLSTISPQESFSHIEESSIGGSDDARLASHRTGHK
LCVNEAKHNKMDTLYAKQFQLNTSVSNHELRVSLPDSSHTEIGGSICSSK
SENDIFKNKLQPCVSTYNVVSLHDVSTKPKKLDLK*

GH26463.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-PA 985 CG3105-PA 1..985 1..985 5097 100 Plus
CG43143-PD 1180 CG11870-PD 73..328 579..835 376 32.7 Plus
CG43143-PG 1199 CG43143-PG 73..328 579..835 376 32.7 Plus
CG43143-PB 1427 CG11870-PB 73..328 579..835 376 32.7 Plus
CG43143-PC 1427 CG11870-PC 73..328 579..835 376 32.7 Plus