Clone GH27042 Report

Search the DGRC for GH27042

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:270
Well:42
Vector:pOT2
Associated Gene/Transcriptshf-RA
Protein status:GH27042.pep: gold
Preliminary Size:1716
Sequenced Size:1802

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3135 2001-01-01 Release 2 assignment
CG3135 2001-07-04 Blastp of sequenced clone
CG3135 2003-01-01 Sim4 clustering to Release 3
shf 2008-04-29 Release 5.5 accounting
shf 2008-08-15 Release 5.9 accounting
shf 2008-12-18 5.12 accounting

Clone Sequence Records

GH27042.complete Sequence

1802 bp (1802 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051622

> GH27042.complete
CTGCAGTGCGACGGTCGCGCCACGAAACTTTGCGGGATTTTTCAAGTGTC
GAAACCGACTCTTTTCGCGTTTGTGTTCAAGCCCCAAAGGAGCTTTCGAG
CCAACGAAATACGTGCAAAGTTTAAGGCTCATGTAAATCGGAACATAAAG
GACCAACAAATCAAGCTTTACTTGTTTTTTACACCCTTGTATTTTGTCAA
CGAAACGACTGTTTGTTTTTTTTTGTTTCAAGCCGGCGACAGCCAACGAC
TGGGGAAACTATGACACATCAGGGCATCGGCTGCCTGGTCAAGTGGTTAT
ATCTGGTGCTGATCGTGCACACGCTCCTCTGCATCGGCCAGCTCGAGTGT
CGCCAGCAGCACCACAATCGGAATAACAATAATAATAACAGAAGAGCGGA
CTCGTCCAGCTCAGAGGAGGGCCACGGCAACACCAGCGATGGCCTGGACA
ACTTCGCAGATCAGGACGCCAGCTTCGTTGGCCATGGACACCAGCCGCGT
CGGGGTCAACGAAAGAAACAGCAGGGAGGTGGAGGAGGAGGCAGCGGCGG
CGGCGGCGGAAACGGAGGAGGCGGTGGAAGCCGGCACAATCGCAACGAGG
AGAGCGGCATCTCGTTGTGGATCAATGAGCAGCAGCTCAAAATGCTTACA
GCGCTCTACTTCCCACAGGGCTACTCGGAGCGCCTGTACGCCATTCACAA
CAGCCGGGTGACCAATGATCTGAGGGACACGACGCTGTACAACTTCCTGG
TAATCCCATCGGAGGTCAACTACGTTAACTTCACATGGAAGTCGGGGCGC
CGCAAATACTTCTACGACTTTGACCGCCTGCAGACCATGGATGAAAGTAT
CTTGAAGGCGCCAACGCTGTCCATTCGCAAGAGCGGACGCATTCCGCAGG
AGCAGAAAAATTTTAGCATATTCCTGCCCTGCACCGGCAACAGCTCCGGC
ACCGCGTCCTTCAACGTCGGCCTCAAGATCCAGACGCGCCACAACAAGCC
GCTCTCGGGCACACCCATTCGCCTCAACTTCAAAAAGGAATGCGCCCACA
GAGGTGTGTATGATATAGACGCTTCCAACCCTACTTCACTAACAACTTTG
CAAGAATGCAGCTTGAAGTGCGGCAAGAACGGGTACTGCAACGAGCACCA
CATCTGCAAGTGCAACGTGGGCTACACGGGCCAATACTGCGAGACGGCCT
TCTGTTTTCCGCAGTGTCTCAATGGCGGTAACTGCACGGCGCCGTCCGTC
TGCACCTGTCCGGAGGGCTACCAGGGCACGCAGTGCGAAGGTGGTATTTG
CAAGGACAAGTGCTTGAATGGCGGCAAGTGTATACAGAAGGACAAGTGCC
AGTGCTCCAAGGGTTACTACGGCCTGCGTTGCGAGTACTCCAAGTGTGTG
ATCCCCTGCAAGAACGAGGGACGGTGCATCGGGAACAACCTGTGCCGCTG
CCCCAACGGACTACGAGGCGATCACTGCGAGATCGGGCGCAAGCAGCGCT
CCATCTGCAAGTGTCGCAATGGCACCTGCGTCTCCCACAAGCACTGCAAG
TGCCATCCGGGATTCTATGGACGCCACTGCAACGGTCGCAAGCGACGACA
TGTCCACCGAAACGATGACTCCAAGTTCTAGGGCTACCGGCGCACACGAT
CCAAAATATTCAATCAACTTTTCACTTTTCTACTAAACCAGCACGACAAG
AACAACAGCAACAGCGACAAAAGGAAGAAACGAAAATAATTCTAATTGTG
ATACATTTTTTTTGTAATTTAACATAACATTTTTAAAAAAAAAAAAAAAA
AA

GH27042.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
shf-RA 2043 shf-RA 194..1991 1..1798 8960 99.8 Plus
shf.a 1635 shf.a 70..924 250..1104 4275 100 Plus
shf.b 1572 shf.b 70..873 250..1053 4020 100 Plus
shf.a 1635 shf.a 935..1630 1103..1798 3450 99.7 Plus
shf.b 1572 shf.b 872..1567 1103..1798 3450 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6666698..6667093 651..250 1885 98.5 Minus
chrX 22417052 chrX 6666322..6666581 907..648 1285 99.6 Minus
chrX 22417052 chrX 6671543..6671792 249..1 1200 99.6 Minus
chrX 22417052 chrX 6663863..6664065 1592..1390 1000 99.5 Minus
chrX 22417052 chrX 6663594..6663790 1784..1588 985 100 Minus
chrX 22417052 chrX 6666052..6666246 1104..910 975 100 Minus
chrX 22417052 chrX 6665189..6665382 1296..1103 970 100 Minus
chrX 22417052 chrX 6664136..6664232 1389..1293 485 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
shf-RA 1371 CG3135-PA 1..1371 261..1631 6855 100 Plus
shf-RB 1383 CG3135-PB 1..1383 261..1631 6700 99.1 Plus
shf-RD 1332 CG3135-PD 1..793 261..1053 3965 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:10:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
shf-RA 1784 CG3135-RA 1..1784 1..1784 8920 100 Plus
shf-RB 1796 CG3135-RB 1..1796 1..1784 8765 99.3 Plus
shf-RD 1745 CG3135-RD 1..1053 1..1053 5265 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
shf-PA 456 CG3135-PA 1..456 261..1628 2383 100 Plus
shf-PB 460 CG3135-PB 1..460 261..1628 2368 99.1 Plus
shf-PD 443 CG3135-PD 1..443 261..1628 2273 96.7 Plus
shf-PC 439 CG3135-PC 1..439 261..1628 2269 96.3 Plus
NimB2-PA 421 CG31839-PA 215..372 1098..1565 284 38 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6774561..6774962 651..250 2010 100 Minus
X 23542271 X 6774183..6774444 909..648 1310 100 Minus
X 23542271 X 6779411..6779659 249..1 1245 100 Minus
X 23542271 X 6771449..6771659 1798..1588 1025 99.1 Minus
X 23542271 X 6771732..6771934 1592..1390 1000 99.5 Minus
X 23542271 X 6773915..6774109 1104..910 975 100 Minus
X 23542271 X 6773058..6773251 1296..1103 970 100 Minus
X 23542271 X 6772005..6772101 1389..1293 485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6782659..6783060 651..250 2010 100 Minus
X 23527363 X 6782281..6782542 909..648 1310 100 Minus
X 23527363 X 6787509..6787757 249..1 1245 100 Minus
X 23527363 X 6779547..6779757 1798..1588 1025 99 Minus
X 23527363 X 6779830..6780032 1592..1390 1000 99.5 Minus
X 23527363 X 6782013..6782207 1104..910 975 100 Minus
X 23527363 X 6781156..6781349 1296..1103 970 100 Minus
X 23527363 X 6780103..6780199 1389..1293 485 100 Minus
Blast to na_te.dros performed 2014-11-26 18:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Fw3 3132 Fw3 FW3 3132bp 2248..2314 78..145 130 67.6 Plus

GH27042.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:10:36 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6671543..6671792 1..249 99   Minus
chrX 6666819..6667093 250..524 100 <- Minus
chrX 6666698..6666771 578..651 100 == Minus
chrX 6666320..6666577 652..909 99 <- Minus
chrX 6666052..6666246 910..1104 100 <- Minus
chrX 6665192..6665380 1105..1293 100 <- Minus
chrX 6664136..6664231 1294..1389 100 <- Minus
chrX 6663868..6664065 1390..1587 100 <- Minus
chrX 6663594..6663790 1588..1784 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:58:12 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1371 261..1631 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:23:25 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1371 261..1631 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:33:34 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1371 261..1631 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:56:10 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1371 261..1631 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:10:36 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1371 261..1631 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:21:05 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1784 1..1784 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:23:25 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1784 1..1784 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:33:34 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1784 1..1784 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:56:11 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1784 1..1784 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:10:36 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1784 1..1784 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:10:36 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
X 6779411..6779659 1..249 100   Minus
X 6774561..6774962 250..651 100 <- Minus
X 6774183..6774440 652..909 100 <- Minus
X 6773915..6774109 910..1104 100 <- Minus
X 6773061..6773249 1105..1293 100 <- Minus
X 6772005..6772100 1294..1389 100 <- Minus
X 6771737..6771934 1390..1587 100 <- Minus
X 6771463..6771659 1588..1784 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:33:34 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6673444..6673692 1..249 100   Minus
arm_X 6668594..6668995 250..651 100 <- Minus
arm_X 6668216..6668473 652..909 100 <- Minus
arm_X 6667948..6668142 910..1104 100 <- Minus
arm_X 6667094..6667282 1105..1293 100 <- Minus
arm_X 6666038..6666133 1294..1389 100 <- Minus
arm_X 6665770..6665967 1390..1587 100 <- Minus
arm_X 6665496..6665692 1588..1784 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:33:55 Download gff for GH27042.complete
Subject Subject Range Query Range Percent Splice Strand
X 6787509..6787757 1..249 100   Minus
X 6782659..6783060 250..651 100 <- Minus
X 6782281..6782538 652..909 100 <- Minus
X 6782013..6782207 910..1104 100 <- Minus
X 6781159..6781347 1105..1293 100 <- Minus
X 6780103..6780198 1294..1389 100 <- Minus
X 6779835..6780032 1390..1587 100 <- Minus
X 6779561..6779757 1588..1784 100 <- Minus

GH27042.pep Sequence

Translation from 260 to 1630

> GH27042.pep
MTHQGIGCLVKWLYLVLIVHTLLCIGQLECRQQHHNRNNNNNNRRADSSS
SEEGHGNTSDGLDNFADQDASFVGHGHQPRRGQRKKQQGGGGGGSGGGGG
NGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRV
TNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKA
PTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSG
TPIRLNFKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNEHHICK
CNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDK
CLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNG
LRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFYGRHCNGRKRRHVHR
NDDSKF*

GH27042.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20838-PA 458 GF20838-PA 1..456 1..448 1899 84.5 Plus
Dana\GF15608-PA 421 GF15608-PA 215..372 280..435 221 38 Plus
Dana\GF12345-PA 4651 GF12345-PA 4167..4359 283..451 200 33 Plus
Dana\Dl-2-PA 829 GF18467-PA 404..572 299..448 190 38 Plus
Dana\GF19599-PA 2722 GF19599-PA 145..327 285..440 186 36.6 Plus
Dana\GF12345-PA 4651 GF12345-PA 4241..4384 278..407 163 36.6 Plus
Dana\Dl-2-PA 829 GF18467-PA 315..491 297..443 163 35 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17656-PA 439 GG17656-PA 1..439 1..456 2075 92.3 Plus
Dere\GG10170-PA 419 GG10170-PA 213..370 280..435 210 39.3 Plus
Dere\GG16063-PA 833 GG16063-PA 404..572 299..448 193 36.3 Plus
Dere\GG23343-PA 4647 GG23343-PA 4181..4355 299..451 190 33.7 Plus
Dere\GG18889-PA 542 GG18889-PA 92..283 290..452 174 30.1 Plus
Dere\GG23343-PA 4647 GG23343-PA 4237..4380 278..407 169 35.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24528-PA 503 GH24528-PA 8..466 7..444 1756 77.3 Plus
Dgri\GH21081-PA 4620 GH21081-PA 4155..4329 299..451 201 35.2 Plus
Dgri\GH10607-PA 408 GH10607-PA 201..359 280..435 195 35.7 Plus
Dgri\GH12488-PA 2768 GH12488-PA 1130..1333 259..440 193 34.9 Plus
Dgri\GH22392-PA 854 GH22392-PA 408..576 299..448 181 37.3 Plus
Dgri\GH21081-PA 4620 GH21081-PA 4253..4450 285..440 170 31.3 Plus
Dgri\GH12488-PA 2768 GH12488-PA 160..329 295..441 170 35.3 Plus
Dgri\GH12488-PA 2768 GH12488-PA 426..635 251..440 153 33.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
shf-PA 456 CG3135-PA 1..456 1..456 2579 100 Plus
shf-PB 460 CG3135-PB 1..460 1..456 2564 99.1 Plus
shf-PD 443 CG3135-PD 1..443 1..456 2469 96.7 Plus
shf-PC 439 CG3135-PC 1..439 1..456 2465 96.3 Plus
NimB2-PA 421 CG31839-PA 215..372 280..435 284 38 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21608-PA 429 GI21608-PA 1..421 1..438 1773 80.6 Plus
Dmoj\GI18681-PA 4639 GI18681-PA 4175..4349 299..451 199 34.4 Plus
Dmoj\GI24477-PA 861 GI24477-PA 400..568 299..448 188 37.9 Plus
Dmoj\GI11173-PA 2819 GI11173-PA 1210..1402 270..440 186 35.9 Plus
Dmoj\GI24477-PA 861 GI24477-PA 315..487 297..443 173 35.3 Plus
Dmoj\GI17397-PA 408 GI17397-PA 202..359 280..435 171 34.5 Plus
Dmoj\GI11173-PA 2819 GI11173-PA 229..398 295..441 169 35.3 Plus
Dmoj\GI11173-PA 2819 GI11173-PA 495..704 251..440 166 34.7 Plus
Dmoj\GI11173-PA 2819 GI11173-PA 595..780 280..440 166 35.5 Plus
Dmoj\GI18681-PA 4639 GI18681-PA 4273..4446 285..421 158 31.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26878-PA 436 GL26878-PA 1..436 1..449 1831 80.7 Plus
Dper\GL21066-PA 418 GL21066-PA 212..369 280..435 205 37.4 Plus
Dper\GL11210-PA 4617 GL11210-PA 4132..4324 283..451 198 33.5 Plus
Dper\GL19950-PA 2412 GL19950-PA 1104..1307 259..440 183 34.9 Plus
Dper\GL11210-PA 4617 GL11210-PA 4248..4445 285..440 182 32.7 Plus
Dper\GL11971-PA 939 GL11971-PA 492..660 299..448 173 35.5 Plus
Dper\GL11210-PA 4617 GL11210-PA 4206..4350 278..408 164 37 Plus
Dper\GL19950-PA 2412 GL19950-PA 134..302 295..440 162 36.1 Plus
Dper\GL19950-PA 2412 GL19950-PA 500..685 280..440 160 35.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16199-PA 435 GA16199-PA 1..435 1..449 1832 81.1 Plus
Dpse\GA29058-PA 398 GA29058-PA 192..349 280..435 204 37.4 Plus
Dpse\GA24641-PA 4552 GA24641-PA 4067..4259 283..451 198 33.5 Plus
Dpse\GA28528-PA 2709 GA28528-PA 1122..1325 259..440 187 34.9 Plus
Dpse\GA24641-PA 4552 GA24641-PA 4183..4380 285..440 183 32.7 Plus
Dpse\GA17563-PB 852 GA17563-PB 403..571 299..448 171 35.5 Plus
Dpse\GA28528-PA 2709 GA28528-PA 152..320 295..440 165 36.1 Plus
Dpse\GA24641-PA 4552 GA24641-PA 4141..4285 278..408 164 37 Plus
Dpse\GA28528-PA 2709 GA28528-PA 518..703 280..440 164 35.5 Plus
Dpse\GA28528-PA 2709 GA28528-PA 418..627 251..440 156 33.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12553-PA 453 GM12553-PA 1..453 1..456 2201 96.7 Plus
Dsec\GM15024-PA 421 GM15024-PA 215..372 280..435 210 38 Plus
Dsec\GM21016-PA 4717 GM21016-PA 4239..4413 299..451 194 34.1 Plus
Dsec\GM26915-PA 834 GM26915-PA 405..573 299..448 193 36.3 Plus
Dsec\GM21016-PA 4717 GM21016-PA 4337..4534 285..440 166 31.2 Plus
Dsec\GM11273-PA 361 GM11273-PA 54..283 253..452 166 27.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16182-PA 239 GD16182-PA 128..239 345..456 584 97.3 Plus
Dsim\GD16182-PA 239 GD16182-PA 1..129 1..132 465 90.2 Plus
Dsim\GD22027-PA 421 GD22027-PA 215..372 280..435 206 38 Plus
Dsim\Dl-PA 823 GD20120-PA 394..562 299..448 192 36.3 Plus
Dsim\GD16007-PA 554 GD16007-PA 92..276 290..452 166 29.6 Plus
Dsim\GD23117-PA 1239 GD23117-PA 793..994 268..450 160 30.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16546-PA 424 GJ16546-PA 1..422 1..444 1664 75.1 Plus
Dvir\GJ18075-PA 399 GJ18075-PA 192..394 280..444 188 32.2 Plus
Dvir\GJ21697-PA 4618 GJ21697-PA 4153..4327 299..451 182 33.5 Plus
Dvir\GJ24543-PA 835 GJ24543-PA 400..568 299..448 177 36.7 Plus
Dvir\GJ15299-PA 2738 GJ15299-PA 1114..1306 270..440 177 34.8 Plus
Dvir\GJ21697-PA 4618 GJ21697-PA 4251..4448 285..440 163 31.8 Plus
Dvir\GJ24543-PA 835 GJ24543-PA 315..487 297..443 163 34.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25838-PA 445 GK25838-PA 5..445 2..444 1888 83.8 Plus
Dwil\GK15110-PA 405 GK15110-PA 199..356 280..435 199 37.4 Plus
Dwil\GK15819-PA 4637 GK15819-PA 4151..4343 283..451 192 32.5 Plus
Dwil\GK17279-PA 2690 GK17279-PA 1105..1308 259..440 188 34.4 Plus
Dwil\GK17279-PA 2690 GK17279-PA 135..303 295..440 182 37.3 Plus
Dwil\GK13480-PA 863 GK13480-PA 410..571 299..441 182 38.3 Plus
Dwil\GK15819-PA 4637 GK15819-PA 4267..4464 285..440 168 32.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16446-PA 454 GE16446-PA 1..454 1..456 2193 97.1 Plus
Dyak\GE25257-PA 420 GE25257-PA 214..371 280..435 213 39.3 Plus
Dyak\GE25135-PA 833 GE25135-PA 404..572 299..448 190 36.3 Plus
Dyak\GE19184-PA 4693 GE19184-PA 4227..4396 299..446 190 34.7 Plus
Dyak\GE17331-PA 556 GE17331-PA 92..283 290..452 173 29.6 Plus
Dyak\GE19184-PA 4693 GE19184-PA 4283..4426 278..407 155 34.5 Plus
Dyak\GE25135-PA 833 GE25135-PA 315..491 297..443 153 33.9 Plus

GH27042.hyp Sequence

Translation from 260 to 1630

> GH27042.hyp
MTHQGIGCLVKWLYLVLIVHTLLCIGQLECRQQHHNRNNNNNNRRADSSS
SEEGHGNTSDGLDNFADQDASFVGHGHQPRRGQRKKQQGGGGGGSGGGGG
NGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRV
TNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKA
PTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSG
TPIRLNFKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNEHHICK
CNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDK
CLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNG
LRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFYGRHCNGRKRRHVHR
NDDSKF*

GH27042.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
shf-PA 456 CG3135-PA 1..456 1..456 2579 100 Plus
shf-PB 460 CG3135-PB 1..460 1..456 2564 99.1 Plus
shf-PD 443 CG3135-PD 1..443 1..456 2469 96.7 Plus
shf-PC 439 CG3135-PC 1..439 1..456 2465 96.3 Plus
NimB2-PA 421 CG31839-PA 215..372 280..435 284 38 Plus