Clone GH27752 Report

Search the DGRC for GH27752

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:277
Well:52
Vector:pOT2
Associated Gene/TranscriptCG8813-RA
Protein status:GH27752.pep: gold
Preliminary Size:1154
Sequenced Size:1013

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8813 2001-01-01 Release 2 assignment
CG8813 2001-10-10 Blastp of sequenced clone
CG8813 2003-01-01 Sim4 clustering to Release 3
CG8813 2008-04-29 Release 5.5 accounting
CG8813 2008-08-15 Release 5.9 accounting
CG8813 2008-12-18 5.12 accounting

Clone Sequence Records

GH27752.complete Sequence

1013 bp (1013 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060808

> GH27752.complete
AGATCAAACAGACCAAATTTCTCGTTAAAAAAAAAAAAACTACTAAAAAA
AATTGTTTTGGCCAATTAGTTTTGTAGATTTCGTTATCAAGATGATGCTA
TCAACCTATCAGCACGACTATGTCCCGCCCAGTGCCAAACGGTACGAGTT
TCTAACGCGGCCCAGGGGCGCCGAGGCTCACAGTGGTCCGCAGGTCAAGG
AGTGCGAATGCGTCGACGAGTCCAAGATCATGATGCCGCCGAACGCGTCT
AAGGACTGTGGCGGCGTCGAGTGGACGGGCATAGCGCCAATGGGAAAGCT
GGTGGATCCGCGTATCATACCCACCCAGCTGACTCAGGACCAGGTGGACA
AGATGGCCTTCTCCGCGGAAACAGATTGCTTTAAGCTGCAACCCAACCGC
TTTCTCAAGATCTTACGTACAGTCTACCCGGATCTGTATGAACGCCTGAA
GGTCATGCCCAAGGAGGAGCTGAGCCGCAGGCTGGAGACCAACCGTATGA
ACACCACCTATCAGATCGATTACTGTAACATGAACGAGTACCCGGAGGGT
ATTTATGAGAGCCTAAAGACGGAGGACGAGTCCAAGAACGCCAACAAGCT
GATGAGCGAACGTGGACCCTGCAACGAGTTCCGCTCGAACGTGATGAACG
AACTGGAGCGGGAGGCGTCCGCTGGCTACGAGATGTCTAGCGACGAGTGC
CAAAAGAACTACAAGCCATTCAAGACCAGCTTCTCGGACTCCTCGCAGAC
CATCGAATCCGGCAGCAGTTCGCACTGGAACTCCGCCCCGACCACATACC
GGAAGGTGCCGACCTTCAGCGAGTACATGGACTCGATAAGCCGGAACGGC
TGCGTCATCATGCGCAACAAGTTGCACGATCACTCCAAGTGCTTGGCCAA
GTACTGCAAGCACGAGCTCAAGTTCACTTGCACTGACATGAAGTAATCGT
CCAAAGACTAGTGCATCTCGAGTCAAATAAATAAATGTAATCCCTAAAAA
AAAAAAAAAAAAA

GH27752.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG8813-RA 998 CG8813-RA 4..998 1..995 4975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2869311..2870305 1..995 4840 99.1 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG8813-RA 855 CG8813-PA 1..855 92..946 4275 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:11:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG8813-RA 998 CG8813-RA 4..998 1..995 4975 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG8813-PA 284 CG8813-PA 1..284 92..943 1529 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2869655..2870650 1..996 4980 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2869655..2870650 1..996 4980 100 Plus
Blast to na_te.dros performed 2014-11-27 10:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker4 7359 Stalker4 STALKER4 7359bp 6271..6310 971..930 115 78.6 Minus
Stalker 7256 Stalker STALKER 7256bp 6165..6204 971..930 115 78.6 Minus

GH27752.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:24:26 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2869311..2870305 1..995 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:59:06 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 1..855 92..946 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:34 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 1..855 92..946 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:45 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 1..855 92..946 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:42 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 1..855 92..946 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:24:26 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 1..855 92..946 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:34 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 4..998 1..995 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:34 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 4..998 1..995 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:45 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 4..998 1..995 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:42 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 4..998 1..995 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:24:26 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG8813-RA 4..998 1..995 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:24:26 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2869655..2870649 1..995 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:45 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2869655..2870649 1..995 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:53 Download gff for GH27752.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2869655..2870649 1..995 100   Plus

GH27752.pep Sequence

Translation from 91 to 945

> GH27752.pep
MMLSTYQHDYVPPSAKRYEFLTRPRGAEAHSGPQVKECECVDESKIMMPP
NASKDCGGVEWTGIAPMGKLVDPRIIPTQLTQDQVDKMAFSAETDCFKLQ
PNRFLKILRTVYPDLYERLKVMPKEELSRRLETNRMNTTYQIDYCNMNEY
PEGIYESLKTEDESKNANKLMSERGPCNEFRSNVMNELEREASAGYEMSS
DECQKNYKPFKTSFSDSSQTIESGSSSHWNSAPTTYRKVPTFSEYMDSIS
RNGCVIMRNKLHDHSKCLAKYCKHELKFTCTDMK*

GH27752.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14988-PA 286 GF14988-PA 1..286 1..284 1324 83.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24894-PA 284 GG24894-PA 1..284 1..284 1475 95.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10683-PA 287 GH10683-PA 1..286 1..284 1124 67.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG8813-PA 284 CG8813-PA 1..284 1..284 1529 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11149-PA 287 GI11149-PA 1..286 1..284 1093 65.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26291-PA 287 GL26291-PA 1..286 1..284 1261 78.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21339-PA 287 GA21339-PA 1..286 1..284 1261 78.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18375-PA 284 GM18375-PA 1..284 1..284 1497 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23190-PA 284 GD23190-PA 1..284 1..284 1502 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18321-PA 287 GJ18321-PA 1..286 1..284 1131 69.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24283-PA 284 GK24283-PA 1..283 1..284 1203 76.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18188-PA 284 GE18188-PA 1..284 1..284 1484 95.8 Plus

GH27752.hyp Sequence

Translation from 91 to 945

> GH27752.hyp
MMLSTYQHDYVPPSAKRYEFLTRPRGAEAHSGPQVKECECVDESKIMMPP
NASKDCGGVEWTGIAPMGKLVDPRIIPTQLTQDQVDKMAFSAETDCFKLQ
PNRFLKILRTVYPDLYERLKVMPKEELSRRLETNRMNTTYQIDYCNMNEY
PEGIYESLKTEDESKNANKLMSERGPCNEFRSNVMNELEREASAGYEMSS
DECQKNYKPFKTSFSDSSQTIESGSSSHWNSAPTTYRKVPTFSEYMDSIS
RNGCVIMRNKLHDHSKCLAKYCKHELKFTCTDMK*

GH27752.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG8813-PA 284 CG8813-PA 1..284 1..284 1529 100 Plus