Clone GH27888 Report

Search the DGRC for GH27888

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:278
Well:88
Vector:pOT2
Associated Gene/TranscriptCG17323-RA
Protein status:GH27888.pep: gold
Preliminary Size:2024
Sequenced Size:1952

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17323 2001-01-01 Release 2 assignment
CG17323 2001-07-04 Blastp of sequenced clone
CG17323 2003-01-01 Sim4 clustering to Release 3
CG17323 2008-04-29 Release 5.5 accounting
CG17323 2008-08-15 Release 5.9 accounting
CG17323 2008-12-18 5.12 accounting

Clone Sequence Records

GH27888.complete Sequence

1952 bp (1952 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051629

> GH27888.complete
CAGCGGCAGTCTTACAAGGTACAATGTGGTCGCCGCGGGTTGCCCTACTT
TTCCTGGCCCTAGCACTTAGCCAACCGGACGAGTTGGTGGAGGCCGCTGG
TCCGCTGAAGGTGCTGGGTCTTTTTCCCCATCCCGGAGTTAGCCACTTCC
ACTTCTTCCACCCCATCATGAAGGGTCTGGCCGAGGCGGGTCATGACGTG
AGCGTGGTTTCCCACTTCCCGGACAAGCATCCGGTTGCCCACTACAAGGA
TTTCCCCCTCACCGGAATGGACAAGCTCACGAACAGTGTTGATCTCAAGT
TTTTCGAGAAGCGCACATTCTACAGTCACTTCCAGGAGTTCTTCCTGCTG
TACGACTGGGGCAAACAGACATGCAACCTGACGCTCCGTTCGGAAGCACT
GCAGCAGATCCTCAGGCGTCCGGGACGCTTTGATGTGATCATCATGGAGC
AATTCAACACTGACTGCATGATGGGAGTGGCCCACCAGCTCCAGGCGCCG
GTGATCGCCTTGAGCAGCTGTGTGATGATGCCCTGGCACTACGAGCGAAT
GGGAGCTCCTTTGATACCCTCTCACATCCCGGCGCTCTTCATGGCCCAGT
CGCAGCACATGAACTTTGGGGGACGACTGGCCAATTGGTTCAGCACCCAC
GCCTTAAATTGGATGTACAAATTACTATCGGTTCCCGCTGCCGACGCCAT
GGTTCAGTACAAATTCGGCCATGACGTGCCTTCGGTGGGCGAGCTGGTGA
AGAACACATCCATGTTCTTTGTGAACCAGCACTACTCGCTGTCTGGACCC
AAGGTAACGCCGCCCAATGTCATCGAGCTGGGTGGCATCCACATCCAGAA
ATCGAAGCCTCTGCCTGCCGATCTGCAGCGCATTCTGGACAATGCTGAGG
AAGGAGTGATCCTGATTAGTTGGGGATCAATGATCCGGGCGAATTCCCTG
TCGGCGGCGAAAAGGGATGGCATTATTCGGGCGGTGGCTCGATTAAAGCA
GAAGGTTATCTGGAAATGGGAAAACGAAACACTGCCTAACCAGCCACCCA
ACATGCACATTATGAAGTGGTTGCCACAACGCGATATCCTCTGCCATCCC
AACGTCAAGGTGTTCATGTCCCACGGCGGACTCATGGGCACCTCGGAGGC
AGCTTACTGTGGAGTCCCAGTGGTTGCGACGCCCATGTATGGCGATCAGT
TTGTCAATACGGCCGCTTTGGTCGAGCGAGGCATGGGAACTATCCTGAAT
TTCGAGGATATAGGCGAAAACACGGTGATGAGGGCACTAAAGAAGGCTTT
GGACAAAAAGTTCCACGATGCTGCCAAAGTAGTCTCCCACTCGTTCCACC
ACCGCCCACAGCAGGCCCTGCATACAGCCATTTGGTGGGTGGAGCATGTG
GCCCACACTGGCGGAGCTCCTCTGTTGAAGCCCAGTGCCGTCGAGATGTC
ACGATTCGTTTACTACTCCCTGGATGTCTATGCCGTGTTGGCCCTCGTCC
TGGGCAGCATCATTGCCAGTTGGGTGTGGCTCCTTCGACTCTGTTGCGGA
TCCAGTGCCGCCCAGAAGACTAAGAAGGATTAGCTCGACTCATCCCTGCA
CAGCTTCGTTTGTGGTCTATGTGATATTTTATATGTTCTGTGTAAGACAT
TTTTAATTCTAAAGACGCCTCCCCCACGGACTGTATCTAGATGTAATCCT
AGCGACGCCAAATTAATTTAATGTTTGATACTATTGGGATTTACCCGATT
AAAACGAACGTAGTTTTCGAATATTGTATCTAGTACGGGAATATTATTAA
AATAATGTTATAATGTTGTAATGAACAACTGCAAGGAACAACTTATTTTT
AAATGAATGGAAATGAACATATTAGAAGAAATATAATATCTGAAAATTGT
TTCTAGTACGGAAATAAATAAAGTTTTTAAAATAAAAAAAAAAAAAAAAA
AA

GH27888.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-RA 2234 CG17323-RA 117..2047 4..1934 9655 100 Plus
CG17323.c 2111 CG17323.c 70..1986 18..1934 9585 100 Plus
CG17323.a 2111 CG17323.a 70..1986 18..1934 9585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18823988..18824628 671..1311 3190 99.8 Plus
chr2L 23010047 chr2L 18824684..18825307 1310..1933 3090 99.7 Plus
chr2L 23010047 chr2L 18823549..18823921 298..670 1850 99.7 Plus
chr2L 23010047 chr2L 18823054..18823335 18..299 1410 100 Plus
chr2L 23010047 chr2L 18827026..18827179 997..1150 245 77.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-RD 1560 CG17323-PD 1..1560 24..1583 7800 100 Plus
CG17323-RC 1560 CG17323-PC 1..1560 24..1583 7800 100 Plus
CG17323-RE 1560 CG17323-PE 1..1560 24..1583 7800 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:11:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-RA 1971 CG17323-RA 42..1971 4..1933 9650 100 Plus
CG17323-RD 2212 CG17323-RD 134..2049 18..1933 9580 100 Plus
CG17323-RC 1988 CG17323-RC 73..1988 18..1933 9580 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-PD 519 CG17323-PD 1..519 24..1580 2768 100 Plus
CG17323-PC 519 CG17323-PC 1..519 24..1580 2768 100 Plus
CG17323-PE 519 CG17323-PE 1..519 24..1580 2768 100 Plus
CG17323-PA 519 CG17323-PA 1..519 24..1580 2768 100 Plus
CG17322-PB 517 CG17322-PB 7..502 48..1541 1570 59.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18825234..18825874 671..1311 3205 100 Plus
2L 23513712 2L 18825930..18826554 1310..1934 3125 100 Plus
2L 23513712 2L 18824795..18825167 298..670 1865 100 Plus
2L 23513712 2L 18824300..18824581 18..299 1410 100 Plus
2L 23513712 2L 18828272..18828425 997..1150 245 77.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18825234..18825874 671..1311 3205 100 Plus
2L 23513712 2L 18825930..18826554 1310..1934 3125 100 Plus
2L 23513712 2L 18824795..18825167 298..670 1865 100 Plus
2L 23513712 2L 18824300..18824581 18..299 1410 100 Plus
2L 23513712 2L 18828272..18828425 997..1150 245 77.2 Plus
2L 23513712 2L 18827661..18827781 445..565 170 76 Plus
Blast to na_te.dros performed on 2014-11-26 23:52:06 has no hits.

GH27888.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:37:48 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18824684..18825307 1310..1933 99   Plus
chr2L 18823988..18824626 671..1309 99 -> Plus
chr2L 18823551..18823921 300..670 99 -> Plus
chr2L 18823054..18823335 18..299 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:59:18 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 1..1560 24..1583 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:23:20 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 1..1560 24..1583 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:06:09 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RE 1..1560 24..1583 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:56:04 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 1..1560 24..1583 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:37:48 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RE 1..1560 24..1583 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:20:58 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 6..1940 1..1933 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:23:20 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 11..1945 1..1933 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:06:09 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 37..1971 1..1933 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:56:05 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 6..1940 1..1933 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:37:48 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 37..1971 1..1933 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:37:48 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18825930..18826553 1310..1933 100   Plus
2L 18825234..18825872 671..1309 100 -> Plus
2L 18824797..18825167 300..670 100 -> Plus
2L 18824300..18824581 18..299 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:06:09 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18825930..18826553 1310..1933 100   Plus
arm_2L 18825234..18825872 671..1309 100 -> Plus
arm_2L 18824797..18825167 300..670 100 -> Plus
arm_2L 18824300..18824581 18..299 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:33:49 Download gff for GH27888.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18825930..18826553 1310..1933 100   Plus
2L 18825234..18825872 671..1309 100 -> Plus
2L 18824797..18825167 300..670 100 -> Plus
2L 18824300..18824581 18..299 100 -> Plus

GH27888.hyp Sequence

Translation from 18 to 1582

> GH27888.hyp
GTMWSPRVALLFLALALSQPDELVEAAGPLKVLGLFPHPGVSHFHFFHPI
MKGLAEAGHDVSVVSHFPDKHPVAHYKDFPLTGMDKLTNSVDLKFFEKRT
FYSHFQEFFLLYDWGKQTCNLTLRSEALQQILRRPGRFDVIIMEQFNTDC
MMGVAHQLQAPVIALSSCVMMPWHYERMGAPLIPSHIPALFMAQSQHMNF
GGRLANWFSTHALNWMYKLLSVPAADAMVQYKFGHDVPSVGELVKNTSMF
FVNQHYSLSGPKVTPPNVIELGGIHIQKSKPLPADLQRILDNAEEGVILI
SWGSMIRANSLSAAKRDGIIRAVARLKQKVIWKWENETLPNQPPNMHIMK
WLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAA
LVERGMGTILNFEDIGENTVMRALKKALDKKFHDAAKVVSHSFHHRPQQA
LHTAIWWVEHVAHTGGAPLLKPSAVEMSRFVYYSLDVYAVLALVLGSIIA
SWVWLLRLCCGSSAAQKTKKD*

GH27888.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-PD 519 CG17323-PD 1..519 3..521 2768 100 Plus
CG17323-PC 519 CG17323-PC 1..519 3..521 2768 100 Plus
CG17323-PE 519 CG17323-PE 1..519 3..521 2768 100 Plus
CG17323-PA 519 CG17323-PA 1..519 3..521 2768 100 Plus
CG17322-PB 517 CG17322-PB 7..502 11..508 1570 59.8 Plus

GH27888.pep Sequence

Translation from 23 to 1582

> GH27888.pep
MWSPRVALLFLALALSQPDELVEAAGPLKVLGLFPHPGVSHFHFFHPIMK
GLAEAGHDVSVVSHFPDKHPVAHYKDFPLTGMDKLTNSVDLKFFEKRTFY
SHFQEFFLLYDWGKQTCNLTLRSEALQQILRRPGRFDVIIMEQFNTDCMM
GVAHQLQAPVIALSSCVMMPWHYERMGAPLIPSHIPALFMAQSQHMNFGG
RLANWFSTHALNWMYKLLSVPAADAMVQYKFGHDVPSVGELVKNTSMFFV
NQHYSLSGPKVTPPNVIELGGIHIQKSKPLPADLQRILDNAEEGVILISW
GSMIRANSLSAAKRDGIIRAVARLKQKVIWKWENETLPNQPPNMHIMKWL
PQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALV
ERGMGTILNFEDIGENTVMRALKKALDKKFHDAAKVVSHSFHHRPQQALH
TAIWWVEHVAHTGGAPLLKPSAVEMSRFVYYSLDVYAVLALVLGSIIASW
VWLLRLCCGSSAAQKTKKD*

GH27888.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15420-PA 516 GF15420-PA 18..516 22..519 2328 85 Plus
Dana\GF15419-PA 446 GF15419-PA 16..429 23..429 1055 45.2 Plus
Dana\GF15245-PA 539 GF15245-PA 32..500 30..484 848 36.2 Plus
Dana\GF16732-PA 520 GF16732-PA 32..513 35..514 758 33.7 Plus
Dana\GF16731-PA 528 GF16731-PA 37..502 40..507 713 32.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21135-PA 519 GG21135-PA 1..519 1..519 2675 97.1 Plus
Dere\GG21136-PA 516 GG21136-PA 22..502 28..507 1577 59.5 Plus
Dere\GG21134-PA 525 GG21134-PA 22..519 29..519 1173 43.9 Plus
Dere\GG17891-PA 522 GG17891-PA 25..503 31..507 694 31.8 Plus
Dere\GG17244-PA 515 GG17244-PA 1..514 1..516 681 32.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10546-PA 520 GH10546-PA 22..520 22..519 2067 73.5 Plus
Dgri\GH10547-PA 518 GH10547-PA 19..516 24..518 1586 58.3 Plus
Dgri\GH10545-PA 530 GH10545-PA 26..508 29..507 1164 44.7 Plus
Dgri\GH13698-PA 565 GH13698-PA 47..523 22..484 748 33.5 Plus
Dgri\GH18169-PA 527 GH18169-PA 18..522 21..519 709 32.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-PD 519 CG17323-PD 1..519 1..519 2768 100 Plus
CG17323-PC 519 CG17323-PC 1..519 1..519 2768 100 Plus
CG17323-PE 519 CG17323-PE 1..519 1..519 2768 100 Plus
CG17323-PA 519 CG17323-PA 1..519 1..519 2768 100 Plus
CG17322-PB 517 CG17322-PB 7..502 9..506 1570 59.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20954-PA 521 GI20954-PA 23..521 22..519 2192 79 Plus
Dmoj\GI20965-PA 519 GI20965-PA 23..508 26..509 1556 57.9 Plus
Dmoj\GI20943-PA 527 GI20943-PA 21..523 22..518 1193 44.8 Plus
Dmoj\GI22628-PA 520 GI22628-PA 3..516 6..517 762 34.8 Plus
Dmoj\GI23855-PA 536 GI23855-PA 7..498 5..484 734 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19446-PA 520 GL19446-PA 22..520 22..519 2373 87 Plus
Dper\GL19444-PA 521 GL19444-PA 23..521 22..519 2365 86.6 Plus
Dper\GL19447-PA 517 GL19447-PA 17..516 20..518 1596 58.1 Plus
Dper\GL19445-PA 517 GL19445-PA 17..516 20..518 1596 58.1 Plus
Dper\GL19442-PA 523 GL19442-PA 3..510 10..509 1143 44 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14457-PA 520 GA14457-PA 22..520 22..519 2371 87 Plus
Dpse\GA14456-PA 517 GA14456-PA 17..516 20..518 1603 58.3 Plus
Dpse\GA14458-PA 523 GA14458-PA 3..510 10..509 1143 44 Plus
Dpse\GA15461-PA 540 GA15461-PA 31..526 29..512 820 35.3 Plus
Dpse\GA19758-PA 520 GA19758-PA 2..511 5..517 693 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17296-PA 519 GM17296-PA 1..519 1..519 2773 99.2 Plus
Dsec\GM17297-PA 516 GM17297-PA 22..502 28..507 1582 60 Plus
Dsec\GM17295-PA 525 GM17295-PA 22..524 29..518 1175 43.7 Plus
Dsec\GM18424-PA 536 GM18424-PA 6..500 5..487 802 34.9 Plus
Dsec\GM26124-PA 519 GM26124-PA 1..481 1..485 647 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24159-PA 519 GD24159-PA 1..519 1..519 2763 99 Plus
Dsim\GD24160-PA 518 GD24160-PA 15..502 21..507 1616 60.3 Plus
Dsim\GD24158-PA 440 GD24158-PA 18..438 106..517 1008 44.2 Plus
Dsim\GD23245-PA 536 GD23245-PA 6..497 5..484 804 34.9 Plus
Dsim\GD20684-PA 526 GD20684-PA 1..514 1..517 654 30.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19920-PA 556 GJ19920-PA 58..556 22..519 2171 78.8 Plus
Dvir\GJ19931-PA 519 GJ19931-PA 25..519 28..519 1584 59.1 Plus
Dvir\GJ19909-PA 525 GJ19909-PA 25..525 29..519 1185 45 Plus
Dvir\GJ21102-PA 541 GJ21102-PA 8..525 3..505 808 34.5 Plus
Dvir\GJ23874-PA 524 GJ23874-PA 24..519 29..519 740 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14592-PA 519 GK14592-PA 11..519 11..519 2269 82.5 Plus
Dwil\GK14591-PA 520 GK14591-PA 8..509 9..508 2085 76.5 Plus
Dwil\GK14593-PA 524 GK14593-PA 24..518 27..518 1649 60.9 Plus
Dwil\GK14590-PA 529 GK14590-PA 2..501 8..507 1150 43.2 Plus
Dwil\GK24667-PA 545 GK24667-PA 12..526 3..505 787 32.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13209-PA 519 GE13209-PA 1..519 1..519 2684 96.7 Plus
Dyak\GE13210-PA 516 GE13210-PA 22..502 28..507 1609 61.4 Plus
Dyak\GE13207-PA 525 GE13207-PA 22..501 29..500 1184 45.6 Plus
Dyak\GE18247-PA 536 GE18247-PA 28..531 30..518 793 34.9 Plus
Dyak\GE24645-PA 519 GE24645-PA 1..517 1..518 706 32.1 Plus