Clone GH28326 Report

Search the DGRC for GH28326

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:283
Well:26
Vector:pOT2
Associated Gene/TranscriptCG32549-RE
Protein status:GH28326.pep: gold
Sequenced Size:2491

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32549-RE 2009-06-22 Replacement based on scoring

Clone Sequence Records

GH28326.complete Sequence

2491 bp assembled on 2009-12-14

GenBank Submission: BT120037.1

> GH28326.complete
ATTTTGCCATCCAAGTGGAAAATCCGAATTCGCATCCGAATAGCAATCGT
AGATACGAAATCCCAAATTGTCAGTTTTTTTTTTTTTTTGTTTTTCTCAC
TCGAAGAGTTTTCCAAACGATCGATCAGTCAGATTCATTCCAACTCCAGA
TCTTGGTGACGTCGTCGTCCGCCAAAATAACAGCTGATAAGATACTTATC
GCTGCTGGTAGCCCCCACAACCACCCCGCGCGCCTACCGACGTTCCACGC
CCACTGGGCGAAAGAGCTTAATCAGCAGCAGCGACGCGGCGCAGCATTTG
TGGCCTTGTAATCCGCGGCAGCTCCAAGATGCCACAGCCAAAGCAAAACC
AGCAGAAACAGCCACAGCCACAACAGCAAAAGCCGCTGCAGAAACATTCC
AGCACCAGCTCCACGATCATCGCCAAGCCGGAAAAGGAACGGGAACGCAC
GCAGACGATCGGCGAAACCGACATGGATCAGTCGGTGCTCAATGGACTGG
CAGTGGGCGCAGATGGAACCGCCGGCTACCATGGTCACAAGCGAGAACTT
GGTCACAGAGTGTTTGTGAACAGATCGCTGCATTTGGAGAATATCAAGTA
CTATGGCTTCGATATGGACTACACCTTGGCAGAGTACAAGTCACCGCAGT
ATGAGCAGCTGGGCTTCAACCTGGTCAAGGAGCGCCTGGTCTTCATGGGC
TACCCCAAGGAGATCCTGCAGTTCGAGTACGATCCCACCTTCCCAGTACG
CGGCCTGTGGTTCGACACTCTCTACGGGAATCTGCTGAAAGTGGATGCCT
ACGGCAACATCCTGGTCTGCGTTCATGGCTTCGAGTTCATCAAACATCAC
CAGGTGTACGAGTTGTATCCCAACAAGTTCTTGAAACTGGACGAGTCGCG
TGTCTATGTCCTGAATACTCTCTTCAATCTTCCTGAAACCTATCTCCTTG
CCTGTCTCGTCGACTTCCTAACCAACAGCAGCGACTTTGTGCGCGTTGAG
CGCGGCATCAAAGCTGGCGATTTACTTTTTACCTACAAGTCGATTTTCCA
GGATGTGCGACGTGCCGTCGACTGGGTGCATTCCGATGGCGATCTGAAGC
GTCGCACCACTCAGAATATGGCTCACTATGTGAAGAAGGACGAGCGTTTG
CCCACGGTCCTTTCGCGAATCCGGGAGTCGGGCGCCAAACTCTTTATGCT
GACCAACAGCGACTATACGTACACCAACGAGATCATGACCTACCTGTTTG
ATTTCCCCCATGGCGCCACTCCGGATGAGCCGCATCGCGACTGGAAGACC
TACTTCGATGTGATCGTGGTGGATGCCCGCAAGCCGCTCTTCTTCGACGA
GGGCACCGTGCTGCGGCAGGTGGACACGAAGACCGGAAGCCTGAAGATCG
GCACACACGTTGGACCCCTGCAGCCGGGTCAGGTTTATTCCGGTGGCTCC
TGCGAGCTCTTTACCAAGTTCATCAATGCCAAAGGCAAGGACGTGCTCTA
TGTGGGCGATCACATTTTTGGCGATATTCTCAAATCGAAGAAGATTCGAG
GCTGGCGCACCTTCCTAATTGTGCCCGAATTGGTGAGGGAGCTGCACGTT
TGGACGGATGAGTGCCAGCTGTTTGCGGAGCTACAGAACCTGGACATCAA
GCTGGGCGACCTGTACAGGGATCTCGACTCGAGTGCCAAGGTCAAGCCGG
ACATTTCGCAGCTGCGCACGTGCATCCGCGATGTGACACACAAGATGGAC
ATGTCCTACGGTATGATGGGCTCACTCTTCCGCTCCGGCTCGCGCCAGAC
CTTCTTCTCCAGCCAGGTGGTGCGATATGCCGACGTCTATGCGGCCACCC
TGCTCAACCTCATTTACTACCCATTCTCGTATATGTTCCGAGCTCCGGCC
ATGCTTCTGCCCCATGAGTCGACGGTGGCCCATGATCAGGCCCATCAGCC
GCCTCCGCCACTGGGCCCTGTTCCTGTTCCGGCTACGGGAGCCGCATCGG
TGGCTGCCTCGCCGGATGAGCCGGCTCGCATTTTGGCGGGCACCGCCGAG
CACGTTAAGGACCCCAAGGACTTGCATCGCGCAAGCTCCATTGTGCACAC
TCGTCCGTCGACGCCCACCGTGGTGACCCACACCCATGACGAGGACTATT
CCGAGGAGGAGGAGACACCCAGTGGTGCCGAGTCTTCCACAGAGGCTGTG
CGCGATGCCTCCGAAGACTAGATGATGCCACAGCCGCCCTTCTGGAATGG
AATGTTTGGATCAACGAATTTTATTCTCAAACTTCCCCAATGCCCCCATT
AGCCTTGCAAACCCTTACCCGAAATCCACACCGTGGTCGAAGCAATTATG
AAACGTACGATTTTCCCTGGCGATTTTACCCAAGCACAGATATGTGAAAC
TATATACCATAACCGATATATATATATATACATTATACATTATACATTAT
AAATTAGCTGGTTCCATACATATAAAAAAAAAAAAAAAAAA

GH28326.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG32549-RE 2588 CG32549-RE 31..2498 1..2475 12230 99.6 Plus
CG32549.c 2488 CG32549.c 110..2428 150..2475 11500 99.6 Plus
CG32549.a 2561 CG32549.a 587..2501 554..2475 9480 99.6 Plus
CG32549.c 2488 CG32549.c 41..109 1..69 330 98.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18280196..18281166 2083..1113 4825 99.8 Minus
chrX 22417052 chrX 18293186..18293743 558..1 2760 99.6 Minus
chrX 22417052 chrX 18279765..18280130 2449..2084 1815 99.7 Minus
chrX 22417052 chrX 18281747..18281963 846..630 1085 100 Minus
chrX 22417052 chrX 18281533..18281679 993..847 735 100 Minus
chrX 22417052 chrX 18281238..18281359 1114..993 610 100 Minus
chrX 22417052 chrX 18282035..18282112 632..555 390 100 Minus
chrX 22417052 chrX 18279748..18279787 2473..2434 200 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG32549-RE 1893 CG32549-PE 1..1893 329..2221 9465 100 Plus
CG32549-RH 2130 CG32549-PH 463..2130 554..2221 8340 100 Plus
CG32549-RG 2130 CG32549-PG 463..2130 554..2221 8340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:11:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG32549-RE 2509 CG32549-RE 44..2492 1..2449 12215 99.9 Plus
CG32549-RH 2677 CG32549-RH 771..2666 554..2449 9465 99.9 Plus
CG32549-RG 2806 CG32549-RG 900..2795 554..2449 9465 99.9 Plus
CG32549-RE 2509 CG32549-RE 2470..2509 2434..2473 200 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG32549-PE 630 CG32549-PE 23..630 395..2218 3072 100 Plus
CG32549-PH 709 CG32549-PH 151..709 542..2218 2802 99.5 Plus
CG32549-PG 709 CG32549-PG 151..709 542..2218 2802 99.5 Plus
CG32549-PF 612 CG32549-PF 54..612 542..2218 2802 99.5 Plus
CG32549-PB 612 CG32549-PB 54..612 542..2218 2802 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18390998..18391968 2083..1113 4855 100 Minus
X 23542271 X 18403985..18404542 558..1 2775 99.8 Minus
X 23542271 X 18390548..18390932 2475..2084 1820 98.2 Minus
X 23542271 X 18392549..18392765 846..630 1085 100 Minus
X 23542271 X 18392335..18392481 993..847 735 100 Minus
X 23542271 X 18392040..18392161 1114..993 610 100 Minus
X 23542271 X 18392837..18392914 632..555 390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18399096..18400066 2083..1113 4855 100 Minus
X 23527363 X 18412083..18412640 558..1 2775 99.8 Minus
X 23527363 X 18398646..18399030 2475..2084 1830 98.2 Minus
X 23527363 X 18400647..18400863 846..630 1085 100 Minus
X 23527363 X 18400433..18400579 993..847 735 100 Minus
X 23527363 X 18400138..18400259 1114..993 610 100 Minus
X 23527363 X 18400935..18401012 632..555 390 100 Minus
Blast to na_te.dros performed 2014-11-27 11:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6947 260..426 214 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2595..2678 347..428 163 70.9 Plus

GH28326.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:26:22 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18293186..18293743 1..558 99   Minus
chrX 18282035..18282108 559..632 100 <- Minus
chrX 18281747..18281960 633..846 100 <- Minus
chrX 18281533..18281679 847..993 100 <- Minus
chrX 18281238..18281358 994..1114 100 <- Minus
chrX 18280196..18281164 1115..2083 99 <- Minus
chrX 18279748..18280130 2084..2473 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:21:32 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 1..1893 329..2221 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:28:32 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 1..1893 329..2221 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:09 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 1..1893 329..2221 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:26:22 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 1..1893 329..2221 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:21:31 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 21..2486 1..2473 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:28:32 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 21..2486 1..2473 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:09 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 44..2509 1..2473 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:26:22 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 44..2509 1..2473 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:26:22 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
X 18403985..18404542 1..558 99   Minus
X 18392837..18392910 559..632 100 <- Minus
X 18392549..18392762 633..846 100 <- Minus
X 18392335..18392481 847..993 100 <- Minus
X 18392040..18392160 994..1114 100 <- Minus
X 18390998..18391966 1115..2083 100 <- Minus
X 18390550..18390932 2084..2473 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:09 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18298018..18298575 1..558 99   Minus
arm_X 18286870..18286943 559..632 100 <- Minus
arm_X 18286582..18286795 633..846 100 <- Minus
arm_X 18286368..18286514 847..993 100 <- Minus
arm_X 18286073..18286193 994..1114 100 <- Minus
arm_X 18285031..18285999 1115..2083 100 <- Minus
arm_X 18284583..18284965 2084..2473 98 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:20 Download gff for GH28326.complete
Subject Subject Range Query Range Percent Splice Strand
X 18412083..18412640 1..558 99   Minus
X 18400935..18401008 559..632 100 <- Minus
X 18400647..18400860 633..846 100 <- Minus
X 18400433..18400579 847..993 100 <- Minus
X 18400138..18400258 994..1114 100 <- Minus
X 18399096..18400064 1115..2083 100 <- Minus
X 18398648..18399030 2084..2473 98 <- Minus

GH28326.pep Sequence

Translation from 328 to 2220

> GH28326.pep
MPQPKQNQQKQPQPQQQKPLQKHSSTSSTIIAKPEKERERTQTIGETDMD
QSVLNGLAVGADGTAGYHGHKRELGHRVFVNRSLHLENIKYYGFDMDYTL
AEYKSPQYEQLGFNLVKERLVFMGYPKEILQFEYDPTFPVRGLWFDTLYG
NLLKVDAYGNILVCVHGFEFIKHHQVYELYPNKFLKLDESRVYVLNTLFN
LPETYLLACLVDFLTNSSDFVRVERGIKAGDLLFTYKSIFQDVRRAVDWV
HSDGDLKRRTTQNMAHYVKKDERLPTVLSRIRESGAKLFMLTNSDYTYTN
EIMTYLFDFPHGATPDEPHRDWKTYFDVIVVDARKPLFFDEGTVLRQVDT
KTGSLKIGTHVGPLQPGQVYSGGSCELFTKFINAKGKDVLYVGDHIFGDI
LKSKKIRGWRTFLIVPELVRELHVWTDECQLFAELQNLDIKLGDLYRDLD
SSAKVKPDISQLRTCIRDVTHKMDMSYGMMGSLFRSGSRQTFFSSQVVRY
ADVYAATLLNLIYYPFSYMFRAPAMLLPHESTVAHDQAHQPPPPLGPVPV
PATGAASVAASPDEPARILAGTAEHVKDPKDLHRASSIVHTRPSTPTVVT
HTHDEDYSEEEETPSGAESSTEAVRDASED*

GH28326.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22508-PA 378 GF22508-PA 23..364 72..416 1758 94.8 Plus
Dana\GF21341-PA 558 GF21341-PA 110..552 78..530 490 29.2 Plus
Dana\GF10066-PA 536 GF10066-PA 105..454 81..421 223 25 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18126-PA 713 GG18126-PA 156..713 72..630 2857 97.5 Plus
Dere\GG24086-PA 547 GG24086-PA 99..541 78..530 493 29.4 Plus
Dere\GG14610-PA 534 GG14610-PA 104..452 81..421 223 26 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12351-PA 611 GH12351-PA 25..611 38..629 2789 89.6 Plus
Dgri\GH19932-PA 539 GH19932-PA 91..533 78..530 493 30.3 Plus
Dgri\GH16005-PA 445 GH16005-PA 17..354 93..418 213 27.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG32549-PE 630 CG32549-PE 1..630 1..630 3331 100 Plus
CG32549-PH 709 CG32549-PH 151..709 72..630 2941 99.5 Plus
CG32549-PG 709 CG32549-PG 151..709 72..630 2941 99.5 Plus
CG32549-PF 612 CG32549-PF 54..612 72..630 2941 99.5 Plus
CG32549-PB 612 CG32549-PB 54..612 72..630 2941 99.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15598-PA 639 GI15598-PA 37..616 36..607 2727 89.5 Plus
Dmoj\GI19889-PA 537 GI19889-PA 89..531 78..530 484 29.4 Plus
Dmoj\GI12272-PA 444 GI12272-PA 6..355 82..418 238 27.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27036-PA 510 GL27036-PA 44..497 162..621 2085 85.7 Plus
Dper\GL17171-PA 499 GL17171-PA 51..493 78..530 478 30.2 Plus
Dper\GL27036-PA 510 GL27036-PA 2..67 12..94 197 57.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22323-PA 576 GA22323-PA 21..563 72..621 2685 90.8 Plus
Dpse\GA25020-PB 551 GA25020-PB 103..545 78..530 487 30.2 Plus
Dpse\GA25020-PC 409 GA25020-PC 8..403 125..530 399 28.2 Plus
Dpse\GA15339-PA 445 GA15339-PA 6..357 82..421 249 25 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22819-PA 637 GM22819-PA 31..637 23..630 3111 98.4 Plus
Dsec\GM21134-PA 481 GM21134-PA 100..433 78..422 424 31.5 Plus
Dsec\GM14224-PA 532 GM14224-PA 31..450 7..421 228 24.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15638-PA 403 GD15638-PA 5..403 78..476 2140 99 Plus
Dsim\GD10664-PA 548 GD10664-PA 100..542 78..530 493 29.6 Plus
Dsim\GD15640-PA 188 GD15640-PA 23..79 23..79 292 98.2 Plus
Dsim\GD13486-PA 534 GD13486-PA 104..452 81..421 235 25.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15201-PA 634 GJ15201-PA 46..634 72..629 2640 85.6 Plus
Dvir\GJ15059-PA 538 GJ15059-PA 90..532 78..530 485 29.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25265-PA 607 GK25265-PA 31..607 46..629 2683 87.3 Plus
Dwil\GK21823-PA 537 GK21823-PA 87..531 76..530 486 29.6 Plus
Dwil\GK20501-PA 430 GK20501-PA 6..353 82..419 172 22.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15532-PA 712 GE15532-PA 155..712 72..630 2862 97.7 Plus
Dyak\GE19287-PA 547 GE19287-PA 99..541 78..530 490 29.4 Plus

GH28326.hyp Sequence

Translation from 328 to 2220

> GH28326.hyp
MPQPKQNQQKQPQPQQQKPLQKHSSTSSTIIAKPEKERERTQTIGETDMD
QSVLNGLAVGADGTAGYHGHKRELGHRVFVNRSLHLENIKYYGFDMDYTL
AEYKSPQYEQLGFNLVKERLVFMGYPKEILQFEYDPTFPVRGLWFDTLYG
NLLKVDAYGNILVCVHGFEFIKHHQVYELYPNKFLKLDESRVYVLNTLFN
LPETYLLACLVDFLTNSSDFVRVERGIKAGDLLFTYKSIFQDVRRAVDWV
HSDGDLKRRTTQNMAHYVKKDERLPTVLSRIRESGAKLFMLTNSDYTYTN
EIMTYLFDFPHGATPDEPHRDWKTYFDVIVVDARKPLFFDEGTVLRQVDT
KTGSLKIGTHVGPLQPGQVYSGGSCELFTKFINAKGKDVLYVGDHIFGDI
LKSKKIRGWRTFLIVPELVRELHVWTDECQLFAELQNLDIKLGDLYRDLD
SSAKVKPDISQLRTCIRDVTHKMDMSYGMMGSLFRSGSRQTFFSSQVVRY
ADVYAATLLNLIYYPFSYMFRAPAMLLPHESTVAHDQAHQPPPPLGPVPV
PATGAASVAASPDEPARILAGTAEHVKDPKDLHRASSIVHTRPSTPTVVT
HTHDEDYSEEEETPSGAESSTEAVRDASED*

GH28326.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG32549-PE 630 CG32549-PE 1..630 1..630 3331 100 Plus
CG32549-PH 709 CG32549-PH 151..709 72..630 2941 99.5 Plus
CG32549-PG 709 CG32549-PG 151..709 72..630 2941 99.5 Plus
CG32549-PF 612 CG32549-PF 54..612 72..630 2941 99.5 Plus
CG32549-PB 612 CG32549-PB 54..612 72..630 2941 99.5 Plus