Clone GM02293 Report

Search the DGRC for GM02293

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:22
Well:93
Vector:pBS SK-
Associated Gene/TranscriptClc-RA
Protein status:GM02293.pep: gold
Preliminary Size:1257
Sequenced Size:1142

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6948 2001-01-01 Release 2 assignment
CG6948 2002-06-10 Blastp of sequenced clone
CG6948 2003-01-01 Sim4 clustering to Release 3
Clc 2008-04-29 Release 5.5 accounting
Clc 2008-08-15 Release 5.9 accounting
Clc 2008-12-18 5.12 accounting

Clone Sequence Records

GM02293.complete Sequence

1142 bp (1142 high quality bases) assembled on 2002-06-10

GenBank Submission: AY121633

> GM02293.complete
TTTTATGGTTGGTTCACGTACTAATGACAGTCATTTTACGTATTCATTGC
TAAAAGAAAACTGAAAAAATACATTTGACCAAGTTTCCGGTTAGTCATCC
GCCCACACCGATCTTCAATTAGTCCTAACCGAATCAAAGGAGAGAGAGCA
CATAGCCATGGACTTCGGAGACGATTTCGCTGCCAAGGAGGACGTGGATC
CGGCGGCCGAGTTCCTGGCGCGCGAACAGTCAGCTCTCGGGGACTTGGAG
GCGGAGATTACGGGTGGATCTGCATCAGCTCCTCCGGCTGCATCCACAGA
CGAGGGCTTGGGTGAGCTTCTGGGAGGCACCGCCTCCGAAGGCGATTTGC
TCTCTGCTGGCGGCACGGGTGGCCTCGAATCCTCCACTGGCAGTTTTGAG
GTCATTGGTGGCGAGTCCAATGAACCCGTGGGCATATCCGGTCCGCCGCC
GTCGCGGGAAGAGCCCGAAAAGATACGCAAATGGCGCGAAGAGCAAAAGC
AACGACTGGAGGAGAAGGACATCGAGGAGGAGCGAAAAAAGGAGGAACTC
CGACAGCAGTCCAAGAAGGAGCTGGACGACTGGTTGCGCCAGATTGGCGA
GTCCATATCGAAGACCAAACTGGCGTCGCGGAATGCCGAGAAACAAGCCG
CCACCCTGGAGAATGGCACCATCGAGCCGGGCACCGAATGGGAGCGCATA
GCCAAGCTCTGCGACTTCAATCCCAAGGTGAACAAGGCGGGAAAGGACGT
CTCCCGCATGCGATCCATCTACCTGCACCTCAAGCAGAATCCCATCCAGG
TGCAGAAGAGCACCTAGGTAGTTTTAATTACGCACTCGCCTAACCACATT
GAGTTGAATATGAAAATTATTATTGAAAGTATTCGCTGTATATTCCAATT
TATGATACATAAAATATTATTATTGCTGCTATAACATAGCCGCGATCATC
GTTTTGTCTAATGAATGCAATAAAGAATGTGCACACAGTTGTCATGCTTT
CCTTGACTATCATATACCCCATCACACAAAATAAGAAAAACGACATGAAA
AAGTTAGGAAAAAGAACAAATAAAAAATAAAACCAAGGATATGACAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM02293.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Clc-RA 1273 Clc-RA 87..1183 1..1097 5470 99.9 Plus
Clc-RC 1246 Clc-RC 294..1246 143..1095 4750 99.8 Plus
Clc-RB 1005 Clc-RB 55..1005 145..1095 4740 99.8 Plus
Clc-RC 1246 Clc-RC 35..178 1..144 720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20231952..20232904 143..1095 4750 99.9 Plus
chr3L 24539361 chr3L 20231693..20231836 1..144 720 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Clc-RD 660 CG6948-PD 1..660 158..817 3285 99.8 Plus
Clc-RC 660 CG6948-PC 1..660 158..817 3285 99.8 Plus
Clc-RB 660 CG6948-PB 1..660 158..817 3285 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:14:38 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Clc-RA 1113 CG6948-RA 19..1113 1..1095 5460 99.9 Plus
Clc-RD 1073 CG6948-RD 121..1073 143..1095 4750 99.9 Plus
Clc-RC 1230 CG6948-RC 278..1230 143..1095 4750 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Clc-PD 219 CG6948-PD 1..219 158..814 766 100 Plus
Clc-PC 219 CG6948-PC 1..219 158..814 766 100 Plus
Clc-PB 219 CG6948-PB 1..219 158..814 766 100 Plus
Clc-PA 219 CG6948-PA 1..219 158..814 766 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20242783..20243737 143..1097 4760 99.9 Plus
3L 28110227 3L 20242524..20242667 1..144 720 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20235883..20236837 143..1097 4760 99.8 Plus
3L 28103327 3L 20235624..20235767 1..144 720 100 Plus
Blast to na_te.dros performed on 2014-11-27 09:34:07 has no hits.

GM02293.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:24:04 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20231954..20232904 145..1095 99   Plus
chr3L 20231693..20231836 1..144 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:01:58 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RA 1..660 158..817 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:26:58 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RC 1..660 158..817 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:13 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RB 1..660 158..817 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:17:28 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RA 1..660 158..817 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:24:04 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RB 1..660 158..817 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:55:30 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RA 35..1129 1..1095 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:26:58 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RA 35..1129 1..1095 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:13 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RA 19..1113 1..1095 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:17:28 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RA 35..1129 1..1095 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:04 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
Clc-RA 19..1113 1..1095 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:24:04 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20242785..20243735 145..1095 99   Plus
3L 20242524..20242667 1..144 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:13 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20235885..20236835 145..1095 99   Plus
arm_3L 20235624..20235767 1..144 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:50:47 Download gff for GM02293.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20235885..20236835 145..1095 99   Plus
3L 20235624..20235767 1..144 100 -> Plus

GM02293.pep Sequence

Translation from 157 to 816

> GM02293.pep
MDFGDDFAAKEDVDPAAEFLAREQSALGDLEAEITGGSASAPPAASTDEG
LGELLGGTASEGDLLSAGGTGGLESSTGSFEVIGGESNEPVGISGPPPSR
EEPEKIRKWREEQKQRLEEKDIEEERKKEELRQQSKKELDDWLRQIGESI
SKTKLASRNAEKQAATLENGTIEPGTEWERIAKLCDFNPKVNKAGKDVSR
MRSIYLHLKQNPIQVQKST*

GM02293.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25317-PA 225 GF25317-PA 1..225 1..219 858 83.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16091-PA 219 GG16091-PA 1..219 1..219 1101 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15111-PA 221 GH15111-PA 1..220 1..218 842 85.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
Clc-PD 219 CG6948-PD 1..219 1..219 1117 100 Plus
Clc-PC 219 CG6948-PC 1..219 1..219 1117 100 Plus
Clc-PB 219 CG6948-PB 1..219 1..219 1117 100 Plus
Clc-PA 219 CG6948-PA 1..219 1..219 1117 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13763-PA 223 GI13763-PA 3..221 1..217 852 84 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 22:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25123-PA 222 GL25123-PA 1..222 1..219 873 87 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19975-PA 222 GA19975-PA 1..222 1..219 873 87 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 22:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22265-PA 219 GM22265-PA 1..219 1..219 1104 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 22:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14863-PA 219 GD14863-PA 1..219 1..219 1118 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13754-PA 223 GJ13754-PA 1..221 1..217 807 83.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 22:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17241-PA 217 GK17241-PA 1..216 1..218 863 86.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19653-PA 219 GE19653-PA 1..219 1..219 1118 99.5 Plus

GM02293.hyp Sequence

Translation from 157 to 816

> GM02293.hyp
MDFGDDFAAKEDVDPAAEFLAREQSALGDLEAEITGGSASAPPAASTDEG
LGELLGGTASEGDLLSAGGTGGLESSTGSFEVIGGESNEPVGISGPPPSR
EEPEKIRKWREEQKQRLEEKDIEEERKKEELRQQSKKELDDWLRQIGESI
SKTKLASRNAEKQAATLENGTIEPGTEWERIAKLCDFNPKVNKAGKDVSR
MRSIYLHLKQNPIQVQKST*

GM02293.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Clc-PD 219 CG6948-PD 1..219 1..219 1117 100 Plus
Clc-PC 219 CG6948-PC 1..219 1..219 1117 100 Plus
Clc-PB 219 CG6948-PB 1..219 1..219 1117 100 Plus
Clc-PA 219 CG6948-PA 1..219 1..219 1117 100 Plus