Clone GM02880 Report

Search the DGRC for GM02880

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:28
Well:80
Vector:pBS SK-
Associated Gene/TranscriptPdp1-RB
Protein status:GM02880.pep: gold
Sequenced Size:1681

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17888 2002-12-10 Blastp of sequenced clone
CG17888 2003-01-01 Sim4 clustering to Release 3
Pdp1 2008-04-29 Release 5.5 accounting
Pdp1 2008-08-15 Release 5.9 accounting
Pdp1 2008-12-18 5.12 accounting

Clone Sequence Records

GM02880.complete Sequence

1681 bp (1681 high quality bases) assembled on 2002-12-10

GenBank Submission: BT003290

> GM02880.complete
CAGCAATCTGCAGGCCAGCAAAAAACCCGCAACGAGACATTTTTTGTTCG
TGTATAATCACAAAATTTCGGAAATTTTTATGAAAAAATGAGCGACAGGG
AGCGATCGTCCCCAACACTGATCGAAACTGGTTTAAAAAACTTAATTGGC
GGCCGTGATGGTAATTACCCACTGATCAGCGGCATTAATGGCAAATCCAC
ATCGAATAGCAAAGAGATCATCTGCCCAGATGACAAATACAAGGAGGAGG
GCGACATCTGGAATGTTGAGGCGCAAACAGCGTTTCTCGGCCCAAATCTG
TGGGACAAGACCCTGCCCTATGATGCCGACCTCAAGGTAACACAATATGC
CGACCTAGACGAATTCCTGTCGGAGAACAACATACCTGATGGCCTGCCCG
GCACGCATCTGGGCCACTCCAGTGGCCTGGGCCACCGGTCCGATTCCCTG
GGTCACGCAGCGGGTCTGTCTCTTGGTCTTGGCCACATAACCACAAAGCG
AGAGCGGTCGCCCTCGCCATCCGACTGCATCAGTCCGGACACGCTAAATC
CGCCATCGCCGGCCGAGTCAACATTTTCGTTCGCCTCCTCGGGCCGTGAC
TTTGATCCGCGAACCAGAGCCTTCTCCGACGAGGAGCTCAAGCCGCAGCC
GATGATCAAAAAGTCACGCAAGCAATTCGTTCCAGATGAGCTCAAGGACG
ACAAGTACTGGGCACGTCGCCGGAAGAACAACATTGCCGCCAAGCGATCC
CGCGATGCCCGGCGCCAGAAGGAGAACCAGATTGCGATGCGGGCACGCTA
CTTGGAGAAGGAAAATGCAACATTACATCAGGAGGTGGAGCAGTTGAAAC
AGGAGAACATGGACTTGCGTGCACGTCTATCGAAATTCCAAGATGTGTAA
TGATAAATACAATTTTGTGACTTGGCCTGAGGACACCACAACAATTAAAT
AATAATAACTATTGATAAAATAACAATAATCATAACTATGATAAAACTAC
TAATAATGTTTAGTACATCAGACATGAAACCTACACTATAAAGTACATAT
TGTATCTAAATATGTATATGCAAAAGTATAATTAGTAAGCAAACACACAC
CCACACAAACACAAGAAACCCCTCACGGCGTCGTGCTCCGCTTTAATATT
TATTTTATGCTAAAAACTAAAAGCAAATTAACTAAACACCGAGGAGGAGA
AACCGACCGAATGGAAACTAAAAACATTTTTTAGAGTAGCCAAAAAAAAA
GAAAGTCTCACGAGAGCAGAGCGTTGAAAAGCTCTGCAGCCGAAGCTTTT
TGCCTTTAAAGTAGCATACTTCCGAGCGCAATGGGAATCCTAAAAAAAAA
ACACAGACGTAGAATTGTTATCTTTTAAATTGTTTAATAGTTGTCTAGCC
TAGTTTTACGCAAAAAAAAAAACACTTCTCTTCTTCGACTTCTTTTGCTA
TTGTTTTCACCCTTCTACTTTAGTTTTTATTATTCTTTGTAATTAGCTGT
TTGATTAAGTTTTTCTTTAGCTTATAGTGAACGGAAATCCACATGCACAC
AACAAATCATATTGTAAATAATTTCGTTGCCTTTTTTCAAATTAACTCGA
GAGAGGAATTACCATAAAATGCAAAAGAAAACATGTATAAAAAATTGCAA
AATGAAAACCCACAAAAAAAAAAAAAAAAAA

GM02880.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1.j 4499 Pdp1.j 1349..2839 190..1680 7395 99.7 Plus
Pdp1.q 4987 Pdp1.q 1349..2839 190..1680 7395 99.7 Plus
Pdp1-RG 4048 Pdp1-RG 1349..2839 190..1680 7395 99.7 Plus
Pdp1.j 4499 Pdp1.j 1118..1310 1..193 965 100 Plus
Pdp1.q 4987 Pdp1.q 1118..1310 1..193 965 100 Plus
Pdp1-RG 4048 Pdp1-RG 1118..1310 1..193 965 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7807652..7808496 1663..814 4060 99.1 Minus
chr3L 24539361 chr3L 7808568..7808809 813..572 1210 100 Minus
chr3L 24539361 chr3L 7809515..7809740 571..346 1100 99.1 Minus
chr3L 24539361 chr3L 7845274..7845464 191..1 955 100 Minus
chr3L 24539361 chr3L 7810145..7810300 345..190 780 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-RK 813 CG17888-PK 1..813 88..900 4065 100 Plus
Pdp1-RP 813 CG17888-PP 1..813 88..900 4065 100 Plus
Pdp1-RB 813 CG17888-PB 1..813 88..900 4065 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:15:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-RK 6855 CG17888-RK 1088..2750 1..1663 8285 99.9 Plus
Pdp1-RP 6398 CG17888-RP 1088..2750 1..1663 8285 99.9 Plus
Pdp1-RB 5065 CG17888-RB 2177..3839 1..1663 8285 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-PK 270 CG17888-PK 1..270 88..897 1131 100 Plus
Pdp1-PP 270 CG17888-PP 1..270 88..897 1131 100 Plus
Pdp1-PB 270 CG17888-PB 1..270 88..897 1131 100 Plus
Pdp1-PM 275 CG17888-PM 1..275 88..897 1110 97.8 Plus
Pdp1-PG 284 CG17888-PG 1..284 88..897 1106 95.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7815546..7816412 1680..814 4275 99.5 Minus
3L 28110227 3L 7816484..7816725 813..572 1210 100 Minus
3L 28110227 3L 7817437..7817662 571..346 1130 100 Minus
3L 28110227 3L 7853182..7853372 191..1 955 100 Minus
3L 28110227 3L 7818069..7818224 345..190 780 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7808646..7809512 1680..814 4275 99.5 Minus
3L 28103327 3L 7809584..7809825 813..572 1210 100 Minus
3L 28103327 3L 7810537..7810762 571..346 1130 100 Minus
3L 28103327 3L 7846282..7846472 191..1 955 100 Minus
3L 28103327 3L 7811169..7811324 345..190 780 100 Minus
Blast to na_te.dros performed 2014-11-26 23:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 135..198 1506..1443 140 68.8 Minus
Juan 4236 Juan JUAN 4236bp 4066..4111 1144..1188 128 78.3 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 1102..1156 1051..1111 119 73.8 Plus

GM02880.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:19:40 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7845275..7845464 1..190 100   Minus
chr3L 7810145..7810299 191..345 100 <- Minus
chr3L 7809515..7809740 346..571 99 <- Minus
chr3L 7808568..7808809 572..813 100 <- Minus
chr3L 7808363..7808496 814..947 100 <- Minus
chr3L 7807652..7808302 1008..1663 98 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:52:25 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1..813 88..900 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:02:14 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1..813 88..900 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:16:49 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1..813 88..900 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:52:37 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1..813 88..900 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:19:40 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1..813 88..900 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:52:24 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1086..2748 1..1663 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:02:14 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1090..2752 1..1663 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:16:49 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 2177..3839 1..1663 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:52:37 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1086..2748 1..1663 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:19:40 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 2177..3839 1..1663 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:19:40 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7853183..7853372 1..190 100   Minus
3L 7818069..7818223 191..345 100 <- Minus
3L 7817437..7817662 346..571 100 <- Minus
3L 7816484..7816725 572..813 100 <- Minus
3L 7815563..7816412 814..1663 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:16:49 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7846283..7846472 1..190 100   Minus
arm_3L 7811169..7811323 191..345 100 <- Minus
arm_3L 7810537..7810762 346..571 100 <- Minus
arm_3L 7809584..7809825 572..813 100 <- Minus
arm_3L 7808663..7809512 814..1663 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:24:38 Download gff for GM02880.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7846283..7846472 1..190 100   Minus
3L 7811169..7811323 191..345 100 <- Minus
3L 7810537..7810762 346..571 100 <- Minus
3L 7809584..7809825 572..813 100 <- Minus
3L 7808663..7809512 814..1663 99 <- Minus

GM02880.pep Sequence

Translation from 87 to 899

> GM02880.pep
MSDRERSSPTLIETGLKNLIGGRDGNYPLISGINGKSTSNSKEIICPDDK
YKEEGDIWNVEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIP
DGLPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISP
DTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPD
ELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEV
EQLKQENMDLRARLSKFQDV*

GM02880.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24150-PA 639 GF24150-PA 397..639 29..270 1198 95.9 Plus
Dana\GF12658-PA 197 GF12658-PA 110..182 192..264 163 46.6 Plus
Dana\GF21952-PA 456 GF21952-PA 390..454 201..265 158 47.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14935-PA 598 GG14935-PA 345..598 18..270 1275 94.9 Plus
Dere\GG12614-PA 444 GG12614-PA 377..432 201..256 157 53.6 Plus
Dere\GG22289-PA 192 GG22289-PA 105..177 192..264 155 45.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23565-PA 573 GH23565-PA 466..573 163..270 603 100 Plus
Dgri\GH17268-PA 53 GH17268-PA 1..36 1..36 185 100 Plus
Dgri\GH17582-PA 457 GH17582-PA 392..456 201..265 159 47.7 Plus
Dgri\GH21058-PA 187 GH21058-PA 101..173 192..264 158 45.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-PK 270 CG17888-PK 1..270 1..270 1417 100 Plus
Pdp1-PP 270 CG17888-PP 1..270 1..270 1417 100 Plus
Pdp1-PB 270 CG17888-PB 1..270 1..270 1417 100 Plus
Pdp1-PM 275 CG17888-PM 1..275 1..270 1396 97.8 Plus
Pdp1-PG 284 CG17888-PG 1..284 1..270 1392 95.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12193-PA 585 GI12193-PA 332..585 18..270 1265 93.7 Plus
Dmoj\GI18660-PA 249 GI18660-PA 163..235 192..264 159 46.6 Plus
Dmoj\GI15181-PA 507 GI15181-PA 442..506 201..265 159 47.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 22:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17823-PA 284 GL17823-PA 1..284 1..270 1406 94.7 Plus
Dper\GL20006-PA 110 GL20006-PA 5..58 35..88 292 96.3 Plus
Dper\GL14307-PA 495 GL14307-PA 429..493 201..265 161 47.7 Plus
Dper\GL11555-PA 217 GL11555-PA 130..202 192..264 160 46.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28498-PA 592 GA28498-PA 339..592 18..270 1274 94.5 Plus
Dpse\GA20715-PA 493 GA20715-PA 427..491 201..265 161 47.7 Plus
Dpse\GA20586-PA 219 GA20586-PA 132..204 192..264 160 46.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 22:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24985-PA 581 GM24985-PA 328..581 18..270 1272 94.9 Plus
Dsec\GM18880-PA 445 GM18880-PA 378..433 201..256 158 53.6 Plus
Dsec\GM20077-PA 192 GM20077-PA 105..177 192..264 152 43.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 22:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13032-PA 647 GD13032-PA 406..647 29..270 1309 98.3 Plus
Dsim\GD15226-PA 192 GD15226-PA 105..177 192..264 155 45.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11425-PA 706 GJ11425-PA 465..706 29..270 1315 96.7 Plus
Dvir\GJ21676-PA 192 GJ21676-PA 106..178 192..264 162 46.6 Plus
Dvir\GJ17061-PA 491 GJ17061-PA 426..490 201..265 160 47.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 22:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10510-PA 610 GK10510-PA 352..610 18..270 1172 90.3 Plus
Dwil\GK20980-PA 196 GK20980-PA 109..181 192..264 164 45.2 Plus
Dwil\GK17868-PA 445 GK17868-PA 378..433 201..256 157 53.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20386-PA 586 GE20386-PA 333..586 18..270 1273 94.9 Plus
Dyak\GE16945-PA 448 GE16945-PA 381..436 201..256 158 53.6 Plus
Dyak\GE14085-PA 192 GE14085-PA 105..177 192..264 155 45.2 Plus

GM02880.hyp Sequence

Translation from 87 to 899

> GM02880.hyp
MSDRERSSPTLIETGLKNLIGGRDGNYPLISGINGKSTSNSKEIICPDDK
YKEEGDIWNVEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIP
DGLPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISP
DTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPD
ELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEV
EQLKQENMDLRARLSKFQDV*

GM02880.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-PK 270 CG17888-PK 1..270 1..270 1417 100 Plus
Pdp1-PP 270 CG17888-PP 1..270 1..270 1417 100 Plus
Pdp1-PB 270 CG17888-PB 1..270 1..270 1417 100 Plus
Pdp1-PM 275 CG17888-PM 1..275 1..270 1396 97.8 Plus
Pdp1-PG 284 CG17888-PG 1..284 1..270 1392 95.1 Plus