Clone GM05069 Report

Search the DGRC for GM05069

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:50
Well:69
Vector:pBS SK-
Associated Gene/TranscriptBx-RA
Protein status:GM05069.pep: gold
Preliminary Size:1467
Sequenced Size:2416

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6500 2001-01-01 Release 2 assignment
CG6500 2001-10-10 Blastp of sequenced clone
Bx 2008-04-29 Release 5.5 accounting
Bx 2008-08-15 Release 5.9 accounting
Bx 2008-12-18 5.12 accounting

Clone Sequence Records

GM05069.complete Sequence

2416 bp (2416 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060902

> GM05069.complete
AGACGACGACGACGACGTAGCGAAACGCAAAAGTTAGCGAAATCATAACA
AAGTCACGGAACACTGTTCATTTTTTTTCCTGTGTACATGCCACAAAAAG
GTAGAAGAGAAACAACAGCAGCAACAACAGCAACGGCAGCAGCAACAGCT
AAACAAGTGCGAAATATGCAAATTTATGAGCTAACTAATTGAGTCGAGTG
TGCGTGCGTGTGTGTGGTGCGTGTTCGTGTGCGTACGTGTGTGTGGCAGG
TGTTTATCAATCTCTCCCTCTCTTTTCTATCGCTCTCGGTGATCTTGCAC
CCACACACAAAATCAGGAATAACAAATAACAAATAACGAATAGCGGTAAA
CGTAAATACCAGTAGCCTGATCTCACGGTCTCTGTCTTGCCCTCCCCCAC
ACTCTCCATCTCCTTCTGACACGCGTGTGGCGAGATTTCGCATTCAATTA
GCGCTAAAATTGAATAACATAAACAATAAGCAAAAACGCATTCCTCTCTC
TCTGTGCAGCAACAACAATTGAATAATAACGACCGGACCGGACCGAACCG
AACCGACCGCAAAAGCTAAATAAATAAATAAATAAATACACAACATACGC
AATTACAACAGCAACAGTAAGAGCCTTGTGCTTCCTGAGAACAACAAATA
CCACAACAACAAACAGCAGGAACAACAACTCAATTTCTGCATATATGATG
ACTATGGACATTACCAAAACCGAACCCGGTCTCGTCGGGCTTTCCTCCAA
CCAACAGCAGCAGCAGCAGCAGCAGTCGCAGCAAAGCAACGCCGGCATGA
ACAGCGGTGGCCAGAACAACGGGCCCAATCCCAATGGCAATGGGAACGTG
GTCAATGTGGTCAACTCCGGCGGTGCCGGTGGCGGCAACAATGGCAACGG
GAATGTCCAGAGCATCGCCGCCGCTGCCAACAATAATAACAATAACAACA
ACAACGGCAGCCAATTGTGCGCCGGCTGCGGCAAGCACATCCAGGACCGC
TATCTCCTCCGCGCCCTGGACATGCTGTGGCACGAGGACTGCCTCAAGTG
CGGCTGCTGCGACTGCCGCCTGGGCGAGGTGGGCTCCACGCTCTACACCA
AGGGCAACCTGATGCTCTGCAAGCGGGACTACTTGAGATTGTTTGGCAAC
ACGGGCTACTGCGCCGCCTGCAGCAAGGTGATCCCAGCCTTCGAGATGGT
GATGCGTGCAAGGACCAATGTCTATCACTTGGAGTGCTTCGCTTGTCAGC
AGTGTAACCACAGATTCTGTGTGGGCGACCGTTTCTACCTGTGCGAGAAC
AAGATACTCTGCGAGTACGACTACGAGGAGCGCCTGGTCTTCGCATCGAT
GGCCAATCATCCGATGCTCAAGCGACACGTCTCCTCCTTGGGCCAGGGCT
CACCGACGGGAGCGGCCGGGGCGCAGAATACAGCTGGTGGATTGCTGGGC
GGCGGACCCGGTGGCGGCAATGTGAATGGCGTGGGCATGGTCAACGGACC
GCGCACCCCTGGCGATCACAATAACAACAACAATGGCCCACAGACACCGA
CCGGCGGTGGCTCACCGTTTGCCGCTGCTGCTGCTGCCGCCGCCGCCGCT
GCCCATATGAAGAATCAACTGGGCGCGTCCAGCTAAAATAAAGCCCTGGG
CATGGGCGCCGCTGGGGCTGTTGTGCCGGGATCTGGAGTCGGCGCTGGAG
TTGGAGTTGGAGTTGGAGCGGCGAGTCAGCAATTCTACTCGGGCTTCGGA
CTACAGCATCAGCACCAGCATCAGCAGCATCATCAACAGCAGCAGCAACA
GCAACAGCTCATGGGATTGGGCCTAGGAATGGGCGGCGGTGGAGGAGTAG
GAGGAGGAGGAGCAGGATCCGCCGGTGGACCAGGCGGAGGGGGAGCAGGA
GGAGGAGGCGTTGGCAGCATCGGAAGCGGCTGCAAGCGCTACCAAAGAAA
GTTTTACAACCGCAACTGAGGAAATCGACGGGCGAGAAAACGCTAGCGGA
AAGGATGCAGAAATCCAGAATCGATATTCAAATCTTCGTTTGCTTTGACT
GAGTTCAAGTTTTATAGTTTTAAAGGCCTAGTTTAGTTAGCCTACAGAAA
AGTACTTGCTGAATTTGCAGACATTTTTAGATCCTAACATTTAAGAGACA
ATATGTTTACTTAGTTCTATTCGAGAATAACCGCCCCATTTGTTTTTAAA
CTAGTTTTATTTTCGTTTCCACTACATACTGTACATATTTTCCTTGTAAA
CTGTTGACGTATTAGCGGGATCCTTTTTTTTTTTTTACATACTCCATATA
GATATATTCGTATTTATCTATGTATATGCATAAATAATTTTATTTTCACG
CTCGAAGCGTGCGGTGCCAAAAGAAATTCAAAGCAGTGCCAAAAAGTTAA
AAAAAAAAAAAAAAAA

GM05069.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-RA 2585 Bx-RA 112..2520 5..2413 11910 99.6 Plus
Bx.e 3038 Bx.e 112..2520 5..2413 11910 99.6 Plus
Bx.g 3405 Bx.g 112..2520 5..2413 11910 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18459733..18460870 1261..2398 5690 100 Plus
chrX 22417052 chrX 18423857..18424550 1..694 3470 100 Plus
chrX 22417052 chrX 18455885..18456327 695..1137 2215 100 Plus
chrX 22417052 chrX 18456684..18456811 1136..1263 640 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-RD 1275 CG44425-PD 1..1275 695..1969 6240 99.3 Plus
Bx-RB 1155 CG44425-PB 212..1155 693..1636 4675 99.7 Plus
Bx-RC 942 CG44425-PC 1..942 695..1636 4665 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:17:15 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-RD 2494 CG44425-RD 73..2466 5..2398 11835 99.6 Plus
Bx-RA 2494 CG44425-RA 73..2466 5..2398 11835 99.6 Plus
Bx-RC 3413 CG44425-RC 413..2302 509..2398 9315 99.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-PD 424 CG44425-PD 1..348 695..1738 870 99.7 Plus
Bx-PB 384 CG44425-PB 69..309 686..1408 861 99.2 Plus
Bx-PC 313 CG44425-PC 1..238 695..1408 860 100 Plus
Bx-PA 313 CG44425-PA 1..238 695..1408 860 100 Plus
Bx-PF 383 CG44425-PF 71..308 695..1408 860 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18570561..18571713 1261..2413 5630 99.2 Plus
X 23542271 X 18534735..18535424 5..694 3450 100 Plus
X 23542271 X 18566696..18567138 695..1137 2215 100 Plus
X 23542271 X 18567509..18567636 1136..1263 640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18578659..18579811 1261..2413 5630 99.2 Plus
X 23527363 X 18542833..18543522 5..694 3450 100 Plus
X 23527363 X 18574794..18575236 695..1137 2215 100 Plus
X 23527363 X 18575607..18575734 1136..1263 640 100 Plus
Blast to na_te.dros performed 2014-11-27 08:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 2731..2802 893..964 125 67.1 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 3132..3208 878..957 122 65 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2627..2663 924..960 122 81.1 Plus

GM05069.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:10:02 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18460381..18460868 1909..2398 99   Plus
chrX 18460281..18460312 1809..1840 100 == Plus
chrX 18460192..18460225 1720..1753 100 == Plus
chrX 18459736..18460132 1264..1660 91 == Plus
chrX 18456686..18456811 1138..1263 100 -> Plus
chrX 18455885..18456327 695..1137 86 -> Plus
chrX 18424445..18424550 589..694 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:34:43 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RB 208..1155 687..1636 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:43:56 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RB 208..1155 687..1636 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:31 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RD 1..1275 695..1969 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:12:47 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RB 208..1155 687..1636 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:10:02 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RD 1..1275 695..1969 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:34:43 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RA 67..2464 1..2398 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:43:56 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RA 67..2464 1..2398 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:31 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RA 69..2466 1..2398 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:12:47 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RA 67..2464 1..2398 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:10:02 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RA 69..2466 1..2398 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:10:02 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
X 18570564..18571698 1264..2398 99   Plus
X 18567511..18567636 1138..1263 100 -> Plus
X 18566696..18567138 695..1137 100 -> Plus
X 18534731..18535424 1..694 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:31 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18464597..18465731 1264..2398 99   Plus
arm_X 18461544..18461669 1138..1263 100 -> Plus
arm_X 18460729..18461171 695..1137 100 -> Plus
arm_X 18428764..18429457 1..694 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:49:18 Download gff for GM05069.complete
Subject Subject Range Query Range Percent Splice Strand
X 18578662..18579796 1264..2398 99   Plus
X 18575609..18575734 1138..1263 100 -> Plus
X 18574794..18575236 695..1137 100 -> Plus
X 18542829..18543522 1..694 99 -> Plus

GM05069.pep Sequence

Translation from 694 to 1635

> GM05069.pep
MMTMDITKTEPGLVGLSSNQQQQQQQQSQQSNAGMNSGGQNNGPNPNGNG
NVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNNNNNGSQLCAGCGKHIQ
DRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF
GNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLC
ENKILCEYDYEERLVFASMANHPMLKRHVSSLGQGSPTGAAGAQNTAGGL
LGGGPGGGNVNGVGMVNGPRTPGDHNNNNNGPQTPTGGGSPFAAAAAAAA
AAAHMKNQLGASS*

GM05069.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 17:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22537-PA 408 GF22537-PA 162..408 71..313 1031 92.3 Plus
Dana\GF14129-PA 241 GF14129-PA 29..216 52..214 317 36.2 Plus
Dana\GF15212-PA 444 GF15212-PA 42..158 92..212 268 39.3 Plus
Dana\GF13843-PA 469 GF13843-PA 131..264 75..210 240 36 Plus
Dana\GF24815-PA 613 GF24815-PA 247..374 90..220 238 39.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 17:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19173-PA 419 GG19173-PA 71..419 1..313 1079 81.9 Plus
Dere\GG23969-PA 241 GG23969-PA 29..216 52..214 313 36.2 Plus
Dere\GG21652-PA 442 GG21652-PA 42..158 92..212 266 39.3 Plus
Dere\ap-PA 469 GG10850-PA 148..264 92..210 237 39.5 Plus
Dere\GG21675-PA 534 GG21675-PA 54..172 92..211 237 40.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 17:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12432-PA 447 GH12432-PA 215..447 88..313 960 88 Plus
Dgri\GH13372-PA 241 GH13372-PA 4..229 28..227 318 33.2 Plus
Dgri\GH13485-PA 451 GH13485-PA 42..158 92..212 263 39.3 Plus
Dgri\GH15398-PA 618 GH15398-PA 253..380 90..220 248 41.4 Plus
Dgri\GH20430-PA 469 GH20430-PA 131..264 75..210 242 36 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-PC 313 CG44425-PC 1..313 1..313 1709 100 Plus
Bx-PA 313 CG44425-PA 1..313 1..313 1709 100 Plus
Bx-PF 383 CG44425-PF 71..383 1..313 1709 100 Plus
Bx-PB 384 CG44425-PB 72..384 1..313 1709 100 Plus
Bx-PD 424 CG44425-PD 1..313 1..313 1709 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 17:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15025-PA 667 GI15025-PA 74..277 1..200 607 78.5 Plus
Dmoj\GI18740-PA 238 GI18740-PA 4..226 28..227 327 33.2 Plus
Dmoj\GI15025-PA 667 GI15025-PA 535..667 191..313 322 72.6 Plus
Dmoj\GI17237-PA 449 GI17237-PA 42..158 92..212 261 39.3 Plus
Dmoj\GI19612-PA 485 GI19612-PA 146..279 75..210 241 36 Plus
Dmoj\GI17017-PA 533 GI17017-PA 62..180 92..211 237 40.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 17:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13160-PA 399 GL13160-PA 101..373 2..292 831 68.9 Plus
Dper\GL19311-PA 399 GL19311-PA 101..373 2..292 830 68.9 Plus
Dper\GL18822-PA 381 GL18822-PA 101..374 2..293 724 64.6 Plus
Dper\GL26985-PA 269 GL26985-PA 120..269 156..313 411 71.1 Plus
Dper\GL19153-PA 241 GL19153-PA 59..229 77..227 303 37.4 Plus
Dper\GL26985-PA 269 GL26985-PA 14..166 1..146 243 61.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 17:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22333-PA 407 GA22333-PA 87..407 1..313 1024 82.4 Plus
Dpse\GA25913-PA 399 GA25913-PA 101..373 2..292 832 69.3 Plus
Dpse\GA19074-PA 241 GA19074-PA 59..229 77..227 303 37.4 Plus
Dpse\GA10505-PA 491 GA10505-PA 99..215 92..212 264 38.5 Plus
Dpse\ap-PA 469 GA21030-PA 131..264 75..210 248 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 17:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22905-PA 382 GM22905-PA 72..382 1..313 1118 98.7 Plus
Dsec\GM11938-PA 241 GM11938-PA 29..216 52..214 314 36.2 Plus
Dsec\GM17030-PA 523 GM17030-PA 127..243 92..212 269 39.3 Plus
Dsec\GM16501-PA 535 GM16501-PA 214..330 92..210 239 39.5 Plus
Dsec\GM25340-PA 637 GM25340-PA 272..399 90..220 236 38.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 17:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17400-PA 371 GD17400-PA 61..371 1..313 1118 98.7 Plus
Dsim\GD22293-PA 241 GD22293-PA 29..216 52..214 314 36.2 Plus
Dsim\GD21780-PA 438 GD21780-PA 42..158 92..212 266 39.3 Plus
Dsim\GD10352-PA 469 GD10352-PA 148..264 92..210 237 39.5 Plus
Dsim\GD14373-PA 642 GD14373-PA 275..402 90..220 236 38.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 17:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15375-PA 151 GJ15375-PA 16..151 190..313 345 72.5 Plus
Dvir\GJ14918-PA 240 GJ14918-PA 4..228 28..227 316 32.4 Plus
Dvir\GJ17996-PA 545 GJ17996-PA 126..242 92..212 265 39.3 Plus
Dvir\GJ13148-PA 588 GJ13148-PA 222..349 90..220 243 40.6 Plus
Dvir\apterous-PA 472 GJ14977-PA 133..266 75..210 242 36 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 17:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17103-PA 460 GK17103-PA 36..348 1..310 961 78.2 Plus
Dwil\GK24239-PA 448 GK24239-PA 42..158 92..212 265 39.3 Plus
Dwil\ap-PA 469 GK10615-PA 132..265 75..210 241 36 Plus
Dwil\GK10148-PA 636 GK10148-PA 268..395 90..220 236 39.8 Plus
Dwil\GK23894-PA 539 GK23894-PA 52..170 92..211 235 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 17:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17735-PA 370 GE17735-PA 61..370 1..313 1128 98.7 Plus
Dyak\GE26318-PA 241 GE26318-PA 29..216 52..214 314 36.2 Plus
Dyak\GE12672-PA 442 GE12672-PA 42..158 92..212 266 39.3 Plus
Dyak\GE19443-PA 469 GE19443-PA 131..264 75..210 237 35.3 Plus
Dyak\GE12696-PA 540 GE12696-PA 54..172 92..211 236 40.2 Plus

GM05069.hyp Sequence

Translation from 694 to 1635

> GM05069.hyp
MMTMDITKTEPGLVGLSSNQQQQQQQQSQQSNAGMNSGGQNNGPNPNGNG
NVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNNNNNGSQLCAGCGKHIQ
DRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF
GNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLC
ENKILCEYDYEERLVFASMANHPMLKRHVSSLGQGSPTGAAGAQNTAGGL
LGGGPGGGNVNGVGMVNGPRTPGDHNNNNNGPQTPTGGGSPFAAAAAAAA
AAAHMKNQLGASS*

GM05069.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-PC 313 CG44425-PC 1..313 1..313 1709 100 Plus
Bx-PA 313 CG44425-PA 1..313 1..313 1709 100 Plus
Bx-PF 383 CG44425-PF 71..383 1..313 1709 100 Plus
Bx-PB 384 CG44425-PB 72..384 1..313 1709 100 Plus
Bx-PD 424 CG44425-PD 1..313 1..313 1709 100 Plus