Clone GM06568 Report

Search the DGRC for GM06568

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:65
Well:68
Vector:pBS SK-
Associated Gene/TranscriptRab11-RA
Protein status:GM06568.pep: gold
Preliminary Size:1969
Sequenced Size:1796

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5771 2001-01-01 Release 2 assignment
CG5771 2001-12-12 Blastp of sequenced clone
CG5771 2003-01-01 Sim4 clustering to Release 3
Rab11 2008-04-29 Release 5.5 accounting
Rab11 2008-08-15 Release 5.9 accounting
Rab11 2008-12-18 5.12 accounting

Clone Sequence Records

GM06568.complete Sequence

1796 bp (1796 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070528

> GM06568.complete
TTGGGAGTGACTAAGTTTTCGTGTAAGAGAAAATTGCAAATAAATGCGCT
GCAAGCAGCTGCAAATCTCCAATTAATACTGCTCCAATTGCCGGAAAAGT
CCTGCCAGCATTTTCGAACGCATCCGAGCTGGAAGAGCAACCGATTTCGC
CACTTAAATACTGATATATACACTTTTCTCTTTCTTTACAACTACAACTG
CAAATAAAAGTGTAAAGTGTGTGAGCCAACGACAAACGCATTAAAGAAAT
CGGCGGCGCGCAGGGATTATTGGATTTCGTTTAGCACCCGCACACACAAA
ACAAAAAGGACGGAACTGGATTTCCAAAGGATATCGAACCGAGCGAGCGA
TAGCAAAACAAATTGAGCAAAATGGGTGCAAGAGAAGACGAGTACGATTA
TCTGTTCAAAGTTGTCCTTATCGGTGACTCCGGTGTTGGCAAAAGTAATT
TGCTCTCACGTTTCACGCGCAATGAATTCAATTTGGAGTCCAAGTCGACG
ATTGGCGTTGAGTTTGCAACGCGCAGCATAGAGGTCGATGGCAAAACAAT
TAAAGCGCAAATCTGGGATACGGCCGGCCAGGAGCGTTATCGCGCCATCA
CCTCTGCCTACTACCGCGGTGCCGTGGGGGCCCTGCTCGTCTATGACATT
GCCAAGCATCTGACCTACGAGAACGTGGAGCGGTGGCTGCGGGAATTGCG
CGACCATGCCGACCAGAACATCGTCATCATGCTGGTGGGCAACAAGTCCG
ACTTGCGGCACTTGCGCTCCGTGCCCACGGACGAGGCGAAGCTGTTTGCC
GAGCGCAACGGCTTGAGTTTCATAGAAACCTCGGCCCTAGACTCGACGAA
CGTTGAAACGGCATTCCAGAACATACTCACAGAGATCTATCGCATTGTGT
CGCAGAAACAAATCAGAGATCCGCCGGAAGGCGACGTCATCCGCCCGTCG
AACGTGGAGCCCATCGACGTAAAGCCGACTGTCACCGCCGATGTGCGCAA
ACAGTGCTGTCAGTGACCGCCCCAAGCAATTTTCGCTATTCCCCGCAACC
GCCAGAACAGCAACATAAACAGAAGCAACAGCAATTACAACTACGACTAC
AAGAGGAGCAGCAGCGGCCAGAACTGCAACACCAAGATCAGGAGCAGCGT
ACACCCGATGGACCGCACAAGATGTCTATGCGTTTGTCAGCCACAGTTTG
TCATGTGCGCATAAATTGATAATTCAAATCTGAGCCGCCACTCTCCACCA
CCAACACCACCACCATCATCAGAAGCAGCAGCAGCAGCAAAAGAATCGAA
AGCAACAACATCCGGCTGTAGTTAACTGCGGTTTAAACTGAAGTTTTATA
TATATACAGATCCATGAGTATCGCATAAATCGACCGCCGCGGAAAGAAAG
CAAGCAAAACTAAACACTCCAAATTCAGTTTAAGCTGTAGAACTATAATT
TATATAAATATACATATATGCTAATATTAAAATATTAATATTATTAATTT
TTCGCAACATAAATATATAGTTGTAATTTCGCGAGCAGAACAACAACAAA
CAACCGGAAATTCTTCGACTTAAACGCAAATTCATTACCACAGCACTGCA
GCTCGGATTTTCTTCTTCGGTTTCTCGCAACATTTTAAACGATTGGCCAC
TTGGTAAAACTAGCTGATAAAGAGAAATCAAACAAAAACAGTTGTAAAAC
TTTAAATGCATAAATGAAACGAAATAACATCATTTGTGTTTGCTATGTTA
AGTGTGATTAAATAAATATAATTTAAATAAAAAAAAAAAAAAAAAA

GM06568.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-RA 1825 Rab11-RA 39..1820 1..1782 8835 99.7 Plus
Rab11-RB 1704 Rab11-RB 132..1703 211..1782 7785 99.6 Plus
Rab8.c 1727 Rab8.c 730..822 557..649 180 79.5 Plus
Rab8.c 1727 Rab8.c 566..615 393..442 145 86 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16939100..16939998 880..1778 4435 99.6 Plus
chr3R 27901430 chr3R 16935300..16935710 1..411 2010 99.3 Plus
chr3R 27901430 chr3R 16938603..16938953 532..882 1725 99.4 Plus
chr3R 27901430 chr3R 16937796..16937921 410..535 615 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-RA 645 CG5771-PA 1..645 372..1016 3165 99.4 Plus
Rab11-RB 645 CG5771-PB 1..645 372..1016 3165 99.4 Plus
Rab8-RC 624 CG8287-PC 177..269 557..649 180 79.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:18:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-RA 1815 CG5771-RA 38..1815 1..1778 8815 99.7 Plus
Rab11-RB 1627 CG5771-RB 60..1627 211..1778 7765 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-PA 214 CG5771-PA 1..214 372..1013 1091 100 Plus
Rab11-PB 214 CG5771-PB 1..214 372..1013 1091 100 Plus
Rab14-PB 239 CG4212-PB 21..205 360..914 481 51.4 Plus
Rab14-PD 215 CG4212-PD 1..181 372..914 478 51.9 Plus
Rab14-PA 215 CG4212-PA 1..181 372..914 478 51.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21115248..21116150 880..1782 4500 99.9 Plus
3R 32079331 3R 21111445..21111855 1..411 2040 99.8 Plus
3R 32079331 3R 21114751..21115101 532..882 1725 99.4 Plus
3R 32079331 3R 21113944..21114069 410..535 615 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20856079..20856981 880..1782 4500 99.8 Plus
3R 31820162 3R 20852276..20852686 1..411 2040 99.7 Plus
3R 31820162 3R 20855582..20855932 532..882 1725 99.4 Plus
3R 31820162 3R 20854775..20854900 410..535 615 99.2 Plus
3L 28103327 3L 19862324..19862408 649..565 170 80 Minus
3L 28103327 3L 19863543..19863592 442..393 145 86 Minus
Blast to na_te.dros performed 2014-11-26 20:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2409..2666 1043..1308 248 58.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6865 1046..1157 242 69.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6664..6836 978..1148 219 62.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2397..2665 1046..1310 213 56.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2590..2834 1068..1324 213 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2406 1051..1148 209 70.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2352..2463 1043..1148 205 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6782..6890 1043..1148 205 69.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6815 1056..1148 195 67.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2394 1060..1148 193 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2442 1043..1145 187 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2322..2390 1246..1314 183 73.9 Plus
roo 9092 roo DM_ROO 9092bp 1042..1132 1221..1314 183 69.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6790 1245..1314 179 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6710..6802 1222..1314 177 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2334..2402 1246..1314 174 72.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6743..6811 1246..1314 174 72.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6842 1246..1312 173 73.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6785..6877 1246..1343 171 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2316..2384 1246..1314 165 71 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..6835 1246..1314 165 71 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2379 1246..1312 164 71.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6764..6828 1246..1310 163 72.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6818..6884 1246..1312 155 70.1 Plus
roo 9092 roo DM_ROO 9092bp 1103..1221 1246..1361 154 62.2 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3266..3351 1042..1124 153 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2316..2385 1243..1312 152 68.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6781 1253..1314 148 71 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6797..6865 1246..1314 147 68.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2375..2442 1242..1309 142 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..7050 1082..1416 142 55 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2413..2496 1233..1312 140 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6812..6878 1246..1312 137 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6854..6942 1043..1134 137 64.1 Plus
roo 9092 roo DM_ROO 9092bp 1054..1107 1257..1310 135 72.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6801..6883 1233..1314 133 63.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1524..1587 1246..1309 131 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2376..2442 1246..1312 128 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1527..1589 1246..1308 126 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2814..2874 1246..1306 125 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6769 1265..1314 124 72 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2811..2855 1246..1290 117 73.3 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 133..206 1226..1297 113 65.3 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9163..9236 1226..1297 113 65.3 Plus

GM06568.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:47:25 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16939723..16939973 1503..1753 99 -> Plus
chr3R 16939369..16939663 1149..1443 99 == Plus
chr3R 16939103..16939275 883..1055 99 == Plus
chr3R 16938605..16938953 534..882 99 -> Plus
chr3R 16937798..16937919 412..533 99 -> Plus
chr3R 16935300..16935710 1..411 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:04:47 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 1..645 372..1016 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:18:20 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 1..645 372..1016 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:46:55 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RB 1..645 372..1016 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:44:28 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 1..645 372..1016 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:47:25 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RB 1..645 372..1016 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:51:18 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 39..1816 1..1778 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:18:19 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 39..1816 1..1778 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:46:55 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 38..1815 1..1778 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:44:28 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 39..1816 1..1778 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:47:25 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 38..1815 1..1778 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:47:25 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21115251..21116146 883..1778 99   Plus
3R 21114753..21115101 534..882 99 -> Plus
3R 21113946..21114067 412..533 99 -> Plus
3R 21111445..21111855 1..411 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:46:55 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16940973..16941868 883..1778 99   Plus
arm_3R 16940475..16940823 534..882 99 -> Plus
arm_3R 16939668..16939789 412..533 99 -> Plus
arm_3R 16937167..16937577 1..411 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:20:43 Download gff for GM06568.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20856082..20856977 883..1778 99   Plus
3R 20855584..20855932 534..882 99 -> Plus
3R 20854777..20854898 412..533 99 -> Plus
3R 20852276..20852686 1..411 99 -> Plus

GM06568.pep Sequence

Translation from 371 to 1015

> GM06568.pep
MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFAT
RSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYE
NVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKLFAERNGLSF
IETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPIDV
KPTVTADVRKQCCQ*

GM06568.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 00:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16497-PA 166 GF16497-PA 1..166 1..214 834 77.6 Plus
Dana\GF14883-PA 239 GF14883-PA 25..237 1..212 486 47.2 Plus
Dana\GF11067-PA 213 GF11067-PA 3..173 8..178 480 54.4 Plus
Dana\GF17263-PA 205 GF17263-PA 1..205 1..213 475 47.4 Plus
Dana\GF10843-PA 207 GF10843-PA 5..193 8..199 463 46.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 00:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24366-PA 214 GG24366-PA 1..214 1..214 1137 100 Plus
Dere\GG23219-PA 213 GG23219-PA 3..173 8..178 480 54.4 Plus
Dere\GG14761-PA 205 GG14761-PA 1..205 1..213 472 46.9 Plus
Dere\GG13365-PA 207 GG13365-PA 5..193 8..199 463 46.1 Plus
Dere\GG21802-PA 213 GG21802-PA 3..162 6..165 433 53.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 00:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18257-PA 214 GH18257-PA 1..214 1..214 1137 100 Plus
Dgri\GH11344-PA 243 GH11344-PA 29..209 1..181 486 51.9 Plus
Dgri\GH21751-PA 213 GH21751-PA 3..213 8..213 481 47.2 Plus
Dgri\GH18937-PA 205 GH18937-PA 1..205 1..213 471 47.4 Plus
Dgri\GH16908-PA 207 GH16908-PA 5..185 8..187 462 48.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 00:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-PA 214 CG5771-PA 1..214 1..214 1091 100 Plus
Rab11-PB 214 CG5771-PB 1..214 1..214 1091 100 Plus
Rab14-PD 215 CG4212-PD 1..181 1..181 478 51.9 Plus
Rab14-PA 215 CG4212-PA 1..181 1..181 478 51.9 Plus
Rab14-PB 239 CG4212-PB 25..205 1..181 478 51.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 00:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23656-PA 214 GI23656-PA 1..214 1..214 1137 100 Plus
Dmoj\GI12880-PA 243 GI12880-PA 29..209 1..181 486 51.9 Plus
Dmoj\GI19298-PA 213 GI19298-PA 3..173 8..178 480 54.4 Plus
Dmoj\GI10837-PA 205 GI10837-PA 1..205 1..213 477 47.4 Plus
Dmoj\GI13664-PA 207 GI13664-PA 5..185 8..187 461 48.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 00:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21786-PA 214 GL21786-PA 1..214 1..214 1137 100 Plus
Dper\GL21269-PA 239 GL21269-PA 25..237 1..212 491 47.7 Plus
Dper\GL11116-PA 213 GL11116-PA 3..173 8..178 480 54.4 Plus
Dper\GL27164-PA 205 GL27164-PA 1..172 1..172 466 53.5 Plus
Dper\GL15675-PA 207 GL15675-PA 5..185 8..187 463 48.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 00:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19116-PA 214 GA19116-PA 1..214 1..214 1137 100 Plus
Dpse\GA18036-PA 239 GA18036-PA 25..237 1..212 491 47.7 Plus
Dpse\GA17076-PA 213 GA17076-PA 3..173 8..178 480 54.4 Plus
Dpse\GA17362-PA 205 GA17362-PA 1..172 1..172 466 53.5 Plus
Dpse\GA23499-PA 207 GA23499-PA 5..185 8..187 463 48.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 00:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15065-PA 214 GM15065-PA 1..214 1..214 1137 100 Plus
Dsec\GM15560-PA 239 GM15560-PA 25..237 1..212 486 47.2 Plus
Dsec\GM20894-PA 200 GM20894-PA 3..173 8..178 478 54.4 Plus
Dsec\GM15089-PA 205 GM15089-PA 1..205 1..213 472 46.9 Plus
Dsec\GM15893-PA 207 GM15893-PA 5..193 8..199 463 46.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 00:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19397-PA 198 GD19397-PA 1..198 1..214 1003 90.7 Plus
Dsim\GD10420-PA 213 GD10420-PA 3..173 8..178 480 54.4 Plus
Dsim\GD23961-PA 239 GD23961-PA 32..237 8..212 477 47.3 Plus
Dsim\GD19996-PA 205 GD19996-PA 1..205 1..213 472 46.9 Plus
Dsim\GD12244-PA 207 GD12244-PA 5..193 8..199 463 46.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 00:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23499-PA 214 GJ23499-PA 1..214 1..214 1137 100 Plus
Dvir\GJ18183-PA 236 GJ18183-PA 22..202 1..181 486 51.9 Plus
Dvir\GJ22175-PA 213 GJ22175-PA 3..213 8..213 481 47.2 Plus
Dvir\GJ14443-PA 205 GJ14443-PA 1..205 1..213 474 46.9 Plus
Dvir\GJ13999-PA 207 GJ13999-PA 5..185 8..187 461 48.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 00:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14185-PA 214 GK14185-PA 1..214 1..214 1133 99.5 Plus
Dwil\GK18273-PA 243 GK18273-PA 29..209 1..181 486 51.9 Plus
Dwil\GK23088-PA 213 GK23088-PA 3..173 8..178 480 54.4 Plus
Dwil\GK12772-PA 205 GK12772-PA 1..205 1..213 474 46.9 Plus
Dwil\GK17214-PA 207 GK17214-PA 5..185 8..187 463 48.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 00:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25707-PA 288 GE25707-PA 89..288 15..214 1062 100 Plus
Dyak\GE19031-PA 239 GE19031-PA 25..237 1..212 486 47.2 Plus
Dyak\GE19072-PA 213 GE19072-PA 3..173 8..178 480 54.4 Plus
Dyak\Rab1-PA 205 GE25003-PA 1..205 1..213 472 46.9 Plus
Dyak\GE22459-PA 207 GE22459-PA 5..193 8..199 463 46.1 Plus
Dyak\GE25707-PA 288 GE25707-PA 1..55 1..55 283 100 Plus

GM06568.hyp Sequence

Translation from 371 to 1015

> GM06568.hyp
MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFAT
RSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYE
NVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKLFAERNGLSF
IETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPIDV
KPTVTADVRKQCCQ*

GM06568.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-PA 214 CG5771-PA 1..214 1..214 1091 100 Plus
Rab11-PB 214 CG5771-PB 1..214 1..214 1091 100 Plus
Rab14-PD 215 CG4212-PD 1..181 1..181 478 51.9 Plus
Rab14-PA 215 CG4212-PA 1..181 1..181 478 51.9 Plus
Rab14-PB 239 CG4212-PB 25..205 1..181 478 51.9 Plus