Clone GM08377 Report

Search the DGRC for GM08377

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:83
Well:77
Vector:pBS SK-
Associated Gene/Transcriptlwr-RA
Protein status:GM08377.pep: gold
Preliminary Size:1453
Sequenced Size:1274

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3018 2001-01-01 Release 2 assignment
CG3018 2001-10-10 Blastp of sequenced clone
CG3018 2003-01-01 Sim4 clustering to Release 3
lwr 2008-04-29 Release 5.5 accounting
lwr 2008-08-15 Release 5.9 accounting
lwr 2008-12-18 5.12 accounting

Clone Sequence Records

GM08377.complete Sequence

1274 bp (1274 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060944

> GM08377.complete
CAAGCGTTCATTCCTGAAAAATTGCGGTAAAAATTGCGAAAAGCGCGAGT
TCCCCCCGCGATTGCAAATAATTAATTTGCTTGGAACCACTGGAGACGCA
AGGACGAACAGAGAGGCCACTTACCCACACACACACATTCGCAGACAGAC
GCGCGTGCAAAAAAGGCCAAGTGGGACTGCTAGCGGAAATCCAGGACTCG
AGGACACGTTCGGGCGGCAGTAGAGAAGCGAGCAAGCAGCGACGACCATG
TCCGGCATTGCTATTACACGATTGGGGGAGGAGCGCAAGGCCTGGCGCAA
GGATCACCCATTCGGGTTCGTCGCACGACCCGCCAAGAACCCTGACGGCA
CCCTCAACCTGATGATCTGGGAGTGCGCCATTCCCGGCAAGAAGTCCACC
CCCTGGGAGGGCGGGCTCTACAAGCTGCGCATGATCTTCAAGGACGACTA
CCCCACCTCGCCGCCCAAGTGCAAGTTCGAACCGCCGCTGTTCCACCCGA
ACGTCTATCCCTCGGGCACCGTTTGCCTGTCGCTGCTGGACGAGGAGAAG
GACTGGCGCCCCGCCATCACCATCAAGCAAATCCTGCTGGGCATCCAGGA
CCTGCTCAACGAGCCGAACATCAAGGACCCGGCCCAGGCGGAGGCCTACA
CCATCTACTGCCAGAACCGACTGGAGTACGAGAAGCGCGTGCGTGCCCAG
GCCCGCGCCATGGCGGCCACCGAGTAGTCGGGCTCCTGCCAACCACCTTT
ACCACATAGACATTAAATACACACATCTAGCCGGTAAGCGTTTGTTTGGA
ATGCTCTCCACGTCTACTTACTTTTAAAGAATCGACTAATTTTGGATAGC
CCCCACGGCCCGAAGCATCTAATTTTTTAATGTTCTGCACTTGCTTAATT
ACCAGCATGTACCATCTGAATAAATACAAATAAGTCCTGTAATTTTTCGA
TGAGGCCCAAAGTGGCCACGTGGCACCCAGAATTCGACGCTCTTTTCAGC
TTCCATTCTGGGTGCAGGTGCCGATTATTCTACGGGCTATTTTGTATCGC
GAGTACTACGTACAAACCTATGTAATTTCAATAAAAATTTATTAGTTGTA
AAAGCTTATGCATTTTAAAGCGGAAAGGATTTCCCAGCAAATGTGCAGTC
GAGCACTTGTTGGTCGTCAGTAGCCGTACAGCTGGATTTAGTGCTTGAAT
TATTCCATATAAAGTTCTTCCTTTTGCTTATTATTTAAGTAACATGACTA
TTTTTAAAAAAAAAAAAAAAAAAA

GM08377.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
lwr-RB 1296 lwr-RB 37..1296 1..1257 6170 99.4 Plus
lwr-RA 1344 lwr-RA 227..1344 143..1257 5460 99.3 Plus
lwr.a 1147 lwr.a 37..823 1..784 3820 99.2 Plus
lwr-RA 1344 lwr-RA 114..228 1..115 575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 541245..542386 1255..114 5680 99.8 Minus
chr2L 23010047 chr2L 542434..542548 116..1 530 99.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
lwr-RD 480 CG3018-PD 1..480 248..727 2355 99.4 Plus
lwr-RC 480 CG3018-PC 1..480 248..727 2355 99.4 Plus
lwr-RB 480 CG3018-PB 1..480 248..727 2355 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:19:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
lwr-RB 1294 CG3018-RB 37..1294 1..1255 6150 99.4 Plus
lwr-RA 1109 CG3018-RA 150..1109 143..1099 4660 99.3 Plus
lwr-RD 1105 CG3018-RD 145..1105 142..1099 4650 99.2 Plus
lwr-RA 1109 CG3018-RA 37..151 1..115 575 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
lwr-PD 159 CG3018-PD 1..159 248..724 863 100 Plus
lwr-PC 159 CG3018-PC 1..159 248..724 863 100 Plus
lwr-PB 159 CG3018-PB 1..159 248..724 863 100 Plus
lwr-PA 159 CG3018-PA 1..159 248..724 863 100 Plus
Ubc6-PC 151 CG2013-PC 1..143 248..697 293 41.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 541234..542381 1258..114 5600 99.4 Minus
2L 23513712 2L 542429..542544 116..1 580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 541234..542381 1258..114 5610 99.3 Minus
2L 23513712 2L 542429..542544 116..1 580 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:32:34 has no hits.

GM08377.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:53:07 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 542435..542548 1..115 99   Minus
chr2L 541245..542384 116..1255 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:05:36 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 1..480 248..727 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:43:04 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 1..480 248..727 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:53:09 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 1..480 248..727 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:11:55 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 1..480 248..727 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:07 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 1..480 248..727 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:25:30 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 29..1286 1..1255 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:43:04 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 29..1286 1..1255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:53:09 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 37..1294 1..1255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:11:56 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 29..1286 1..1255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:07 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
lwr-RB 37..1294 1..1255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:53:07 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
2L 542430..542544 1..115 100   Minus
2L 541237..542379 116..1255 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:53:09 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 542430..542544 1..115 100   Minus
arm_2L 541237..542379 116..1255 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:48:20 Download gff for GM08377.complete
Subject Subject Range Query Range Percent Splice Strand
2L 542430..542544 1..115 100   Minus
2L 541237..542379 116..1255 99 <- Minus

GM08377.pep Sequence

Translation from 247 to 726

> GM08377.pep
MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKS
TPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEE
KDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKRVRA
QARAMAATE*

GM08377.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 16:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24729-PA 159 GF24729-PA 1..159 1..159 850 100 Plus
Dana\GF22442-PA 164 GF22442-PA 5..156 5..158 432 51.9 Plus
Dana\GF22493-PA 164 GF22493-PA 5..156 5..158 432 51.9 Plus
Dana\GF20232-PA 158 GF20232-PA 2..137 12..152 403 50.4 Plus
Dana\GF16080-PA 151 GF16080-PA 1..143 1..150 297 41.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 16:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24645-PA 159 GG24645-PA 1..159 1..159 848 99.4 Plus
Dere\GG11277-PA 151 GG11277-PA 1..143 1..150 297 41.3 Plus
Dere\GG19056-PA 167 GG19056-PA 1..160 1..153 257 35.4 Plus
Dere\GG21088-PA 147 GG21088-PA 1..146 4..156 236 34 Plus
Dere\GG24787-PA 169 GG24787-PA 22..166 5..156 223 34.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 16:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10511-PA 159 GH10511-PA 1..159 1..159 848 99.4 Plus
Dgri\GH15302-PA 151 GH15302-PA 1..143 1..150 297 41.3 Plus
Dgri\GH24823-PA 167 GH24823-PA 1..160 1..153 248 34.1 Plus
Dgri\GH14086-PA 147 GH14086-PA 1..146 4..156 236 34 Plus
Dgri\GH14479-PA 324 GH14479-PA 70..207 37..157 225 38.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
lwr-PD 159 CG3018-PD 1..159 1..159 863 100 Plus
lwr-PC 159 CG3018-PC 1..159 1..159 863 100 Plus
lwr-PB 159 CG3018-PB 1..159 1..159 863 100 Plus
lwr-PA 159 CG3018-PA 1..159 1..159 863 100 Plus
Ubc6-PC 151 CG2013-PC 1..143 1..150 293 41.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 16:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18029-PA 159 GI18029-PA 1..159 1..159 850 100 Plus
Dmoj\GI22506-PA 151 GI22506-PA 1..143 1..150 297 41.3 Plus
Dmoj\GI16154-PA 167 GI16154-PA 1..160 1..153 249 34.1 Plus
Dmoj\GI10619-PA 147 GI10619-PA 1..146 4..156 236 34 Plus
Dmoj\GI13630-PA 321 GI13630-PA 68..205 37..157 224 38.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 16:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19258-PA 159 GL19258-PA 1..159 1..159 847 99.4 Plus
Dper\GL19266-PA 159 GL19266-PA 1..156 1..156 721 84 Plus
Dper\GL22213-PA 151 GL22213-PA 1..143 1..150 297 41.3 Plus
Dper\GL18350-PA 167 GL18350-PA 1..160 1..153 258 35.4 Plus
Dper\GL20230-PA 178 GL20230-PA 1..162 1..159 252 37 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 16:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15704-PA 159 GA15704-PA 1..159 1..159 847 99.4 Plus
Dpse\GA25892-PA 159 GA25892-PA 1..156 1..156 726 84 Plus
Dpse\GA15184-PA 151 GA15184-PA 1..143 1..150 297 41.3 Plus
Dpse\GA15184-PB 118 GA15184-PB 1..110 39..150 266 44.6 Plus
Dpse\GA18185-PA 167 GA18185-PA 1..160 1..153 258 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 16:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16662-PA 159 GM16662-PA 1..159 1..159 850 100 Plus
Dsec\GM10669-PA 151 GM10669-PA 1..143 1..150 297 41.3 Plus
Dsec\GM25828-PA 147 GM25828-PA 1..146 4..156 236 34 Plus
Dsec\GM16815-PA 164 GM16815-PA 19..159 2..149 232 35.8 Plus
Dsec\GM25907-PA 168 GM25907-PA 1..161 1..153 222 32.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 16:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22953-PA 159 GD22953-PA 1..159 1..159 850 100 Plus
Dsim\GD19645-PA 151 GD19645-PA 1..143 1..150 297 41.3 Plus
Dsim\GD24840-PA 167 GD24840-PA 1..160 1..153 276 37.2 Plus
Dsim\GD20402-PA 147 GD20402-PA 1..146 4..156 236 34 Plus
Dsim\GD23095-PA 164 GD23095-PA 19..159 2..149 232 35.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 16:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19711-PA 159 GJ19711-PA 1..159 1..159 850 100 Plus
Dvir\GJ10109-PA 151 GJ10109-PA 1..143 1..150 297 41.3 Plus
Dvir\GJ16432-PA 167 GJ16432-PA 1..160 1..153 250 34.1 Plus
Dvir\GJ22971-PA 147 GJ22971-PA 1..146 4..156 236 34 Plus
Dvir\GJ13967-PA 318 GJ13967-PA 68..205 37..157 225 38.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 16:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24638-PA 159 GK24638-PA 1..159 1..159 846 99.4 Plus
Dwil\GK15431-PA 157 GK15431-PA 1..156 1..156 594 66.7 Plus
Dwil\GK14053-PA 151 GK14053-PA 1..143 1..150 297 41.3 Plus
Dwil\GK16076-PA 167 GK16076-PA 1..160 1..153 252 35.4 Plus
Dwil\GK11688-PA 147 GK11688-PA 1..146 4..156 236 34 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 16:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16073-PA 159 GE16073-PA 1..159 1..159 850 100 Plus
Dyak\GE25319-PA 151 GE25319-PA 1..143 1..150 297 41.3 Plus
Dyak\crl-PA 167 GE17278-PA 1..160 1..153 257 35.4 Plus
Dyak\eff-PA 147 GE26430-PA 1..146 4..156 236 34 Plus
Dyak\GE24416-PA 168 GE24416-PA 1..161 1..153 223 32.1 Plus

GM08377.hyp Sequence

Translation from 247 to 726

> GM08377.hyp
MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKS
TPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEE
KDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKRVRA
QARAMAATE*

GM08377.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
lwr-PD 159 CG3018-PD 1..159 1..159 863 100 Plus
lwr-PC 159 CG3018-PC 1..159 1..159 863 100 Plus
lwr-PB 159 CG3018-PB 1..159 1..159 863 100 Plus
lwr-PA 159 CG3018-PA 1..159 1..159 863 100 Plus
Ubc6-PC 151 CG2013-PC 1..143 1..150 293 41.3 Plus