Clone GM08440 Report

Search the DGRC for GM08440

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:84
Well:40
Vector:pBS SK-
Associated Gene/TranscriptCG8635-RA
Protein status:GM08440.pep: gold
Preliminary Size:1605
Sequenced Size:1402

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8635 2001-01-01 Release 2 assignment
CG8635 2001-10-10 Blastp of sequenced clone
CG8635 2003-01-01 Sim4 clustering to Release 3
CG8635 2008-04-29 Release 5.5 accounting
CG8635 2008-08-15 Release 5.9 accounting
CG8635 2008-12-18 5.12 accounting

Clone Sequence Records

GM08440.complete Sequence

1402 bp (1402 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060945

> GM08440.complete
TTCCAGCGTGGTTGTGCAAAAAACTTCGTTTGAACTTTATTTCTACATTT
AAGTTATTAAATTCCCGTATCCCGCCCGAAGATGCCACCCAAAAAGGCGC
CACCAGGTCCCAGCAAGAAGACGGAGCAGAAAAAGAAGGAGAAAGTCATT
GAGGACAAAACCTTCGGGCTGAAGAACAAGAAGGGCAACAAGCAGCAGAA
GTTCATCCAGCAGGTGCAGAAGCAGGTCCAGTCCGGCGGACAGCATCCTC
GCCAGGATGGCGACAAGCGCAAGGAGGAGAAGGAGAAGAAGCTGGCCGAA
CAGCGCGAGATGGCGCTGATCTTCAAGCCGGTACAGACTCAGAAGGTGGA
GAAGGGCACCGATCCCAAGTCGGTGGTCTGCGCCTTCTTCAAACAGGGCA
CCTGCACCAAGGGCGACAAGTGCAAGTTCTCCCACGATCTTTCCCAGGAG
AACAAGGTCGAAAAGCGGTCCATTTATGTGGACATGCGCGACGAGGACGA
TCCGATGACCAACTGGGACGATGCCAAGCTGAAGGAGGTGGTCGAGAAGA
AGAGCTCCGGCGAAAAGCAACGTCCCACCACGGATATTATTTGCAAATTC
TTCCTGGAAGCTGTGGAAAAATCAAAGTACGGCTGGTTCTGGGAGTGCCC
CAACGGCGGAAAGTGCATCTACCGTCACGCCTTGCCAGCTGGATATGTGC
TGAAGCGCGATAAGAAGAAGGAGGAAAAGCCCACGGAAATCTCGCTGGTC
GATTTAATTGAGAAGGAGCGCGCTGCCCTCGGTCCCAACCAGACACGCGT
CACCCTCGAGTCCTTCCTCGCCTGGAAGAAGCGCAAGATTGCCGAGAAGA
AGGCCAAGCTGGCTGCCGAGGAAGAGCGCAAGAAGAGTGACTTCAGCAAG
GGCAAACAGTTCGGCATCTCTGGTCGCGAAATGTTCAGCTTCAATCCGGA
TCTGGTCGACGACGGACCCATGGAGGAGGGCGACGCTGCTTTCGACGTCT
ACAACAGGGAGGACGACGACGATAATGCCGTCGAGTTCAAGGAACTGGAT
CTGGCTGCCCTGTCGCTGGCCGCCAAGGAGGTGGACGGCTCGGGCACCAT
TGCCTCCACCAATCGACTACTGGACCAGGCAACCGAAGCAGCCAAAACCG
CCGCAGCCGAGGACGCAGCGGCCGACGAGGATGGCCCATCGTCGTCTGCA
CCCGCCAACGATGCTGCCCCCATCAACAAGGATCTCTTTGTTGATCTGGC
CGGCGAACTGGATGACCTAGATCTGGACGATGAGGACGATGACTAGTCCT
CCGCGTAGTTTGTTTGAAATGAGTTTGAAATTGATTTCTGCCTTTTAGCT
ACCCTTCAATCAATAAAGTTGTGGCTCTTAAAAAAAAAAAAAAAAAAAAA
AA

GM08440.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-RA 1648 CG8635-RA 182..1562 1..1381 6905 100 Plus
CG8635.a 1324 CG8635.a 69..1297 153..1381 6145 100 Plus
CG8635.a 1324 CG8635.a 1..42 113..154 210 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4517834..4518624 1379..589 3940 99.9 Minus
chr2R 21145070 chr2R 4518683..4519119 588..152 2185 100 Minus
chr2R 21145070 chr2R 4519243..4519396 154..1 770 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-RB 1215 CG8635-PB 1..1215 82..1296 6075 100 Plus
CG8635-RA 1215 CG8635-PA 1..1215 82..1296 6075 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:19:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-RB 1447 CG8635-RB 53..1431 1..1379 6895 100 Plus
CG8635-RA 1572 CG8635-RA 178..1556 1..1379 6895 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-PB 404 CG8635-PB 22..391 145..1254 1315 100 Plus
CG8635-PA 404 CG8635-PA 22..391 145..1254 1315 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8630221..8631013 1381..589 3965 100 Minus
2R 25286936 2R 8631072..8631508 588..152 2185 100 Minus
2R 25286936 2R 8631632..8631785 154..1 770 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8631420..8632212 1381..589 3965 100 Minus
2R 25260384 2R 8632271..8632707 588..152 2185 100 Minus
2R 25260384 2R 8632831..8632984 154..1 770 100 Minus
Blast to na_te.dros performed on 2014-11-27 04:49:57 has no hits.

GM08440.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:20:17 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4519244..4519396 1..153 100   Minus
chr2R 4518683..4519117 154..588 100 <- Minus
chr2R 4517834..4518624 589..1379 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:05:38 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 1..1215 82..1296 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:43:06 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 1..1215 82..1296 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:26:54 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 1..1215 82..1296 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:11:57 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 1..1215 82..1296 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:17 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 1..1215 82..1296 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:25:32 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 178..1556 1..1379 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:43:06 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 178..1556 1..1379 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:26:54 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 178..1556 1..1379 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:11:59 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 178..1556 1..1379 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:17 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 178..1556 1..1379 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:20:17 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8631633..8631785 1..153 100   Minus
2R 8631072..8631506 154..588 100 <- Minus
2R 8630223..8631013 589..1379 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:26:54 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4519138..4519290 1..153 100   Minus
arm_2R 4518577..4519011 154..588 100 <- Minus
arm_2R 4517728..4518518 589..1379 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:48:21 Download gff for GM08440.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8632832..8632984 1..153 100   Minus
2R 8632271..8632705 154..588 100 <- Minus
2R 8631422..8632212 589..1379 100 <- Minus

GM08440.pep Sequence

Translation from 81 to 1295

> GM08440.pep
MPPKKAPPGPSKKTEQKKKEKVIEDKTFGLKNKKGNKQQKFIQQVQKQVQ
SGGQHPRQDGDKRKEEKEKKLAEQREMALIFKPVQTQKVEKGTDPKSVVC
AFFKQGTCTKGDKCKFSHDLSQENKVEKRSIYVDMRDEDDPMTNWDDAKL
KEVVEKKSSGEKQRPTTDIICKFFLEAVEKSKYGWFWECPNGGKCIYRHA
LPAGYVLKRDKKKEEKPTEISLVDLIEKERAALGPNQTRVTLESFLAWKK
RKIAEKKAKLAAEEERKKSDFSKGKQFGISGREMFSFNPDLVDDGPMEEG
DAAFDVYNREDDDDNAVEFKELDLAALSLAAKEVDGSGTIASTNRLLDQA
TEAAKTAAAEDAAADEDGPSSSAPANDAAPINKDLFVDLAGELDDLDLDD
EDDD*

GM08440.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 16:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12572-PA 406 GF12572-PA 1..389 1..387 1585 93.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 16:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10627-PA 406 GG10627-PA 1..404 1..404 2098 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 16:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21804-PA 401 GH21804-PA 1..358 1..356 1499 90.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-PB 404 CG8635-PB 1..404 1..404 2103 100 Plus
CG8635-PA 404 CG8635-PA 1..404 1..404 2103 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 16:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20775-PA 400 GI20775-PA 1..381 1..386 1508 88.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 16:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11672-PA 406 GL11672-PA 1..394 1..391 1556 89.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 16:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21225-PA 406 GA21225-PA 1..394 1..391 1556 89.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 16:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20672-PA 404 GM20672-PA 1..404 1..404 2090 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 16:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10149-PA 754 GD10149-PA 1..397 1..397 2051 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 16:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20510-PA 402 GJ20510-PA 1..382 1..387 1546 89.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 16:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21573-PA 410 GK21573-PA 1..394 1..387 1499 85.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 16:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22859-PA 404 GE22859-PA 1..404 1..404 2084 98.3 Plus

GM08440.hyp Sequence

Translation from 81 to 1295

> GM08440.hyp
MPPKKAPPGPSKKTEQKKKEKVIEDKTFGLKNKKGNKQQKFIQQVQKQVQ
SGGQHPRQDGDKRKEEKEKKLAEQREMALIFKPVQTQKVEKGTDPKSVVC
AFFKQGTCTKGDKCKFSHDLSQENKVEKRSIYVDMRDEDDPMTNWDDAKL
KEVVEKKSSGEKQRPTTDIICKFFLEAVEKSKYGWFWECPNGGKCIYRHA
LPAGYVLKRDKKKEEKPTEISLVDLIEKERAALGPNQTRVTLESFLAWKK
RKIAEKKAKLAAEEERKKSDFSKGKQFGISGREMFSFNPDLVDDGPMEEG
DAAFDVYNREDDDDNAVEFKELDLAALSLAAKEVDGSGTIASTNRLLDQA
TEAAKTAAAEDAAADEDGPSSSAPANDAAPINKDLFVDLAGELDDLDLDD
EDDD*

GM08440.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-PB 404 CG8635-PB 1..404 1..404 2103 100 Plus
CG8635-PA 404 CG8635-PA 1..404 1..404 2103 100 Plus