Clone GM13002 Report

Search the DGRC for GM13002

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:130
Well:2
Vector:pOT2
Associated Gene/Transcriptl(1)G0334-RA
Protein status:GM13002.pep: gold
Sequenced Size:1727

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
l(1)G0334-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

GM13002.complete Sequence

1727 bp assembled on 2011-01-03

GenBank Submission: BT125860.1

> GM13002.complete
AATCGGCCAAGTGATATATAGCGTGCGATTCTAGATCCGGACAATCCGCA
TATAGAAAGCCCCCATTCACATCCAATTTCTGTCAGTCGAACGAGAATAA
CACAGCGAAAATGTTGCGTACTCTGTCACGCGTTAGCGAATTGCCCATTA
TTGTTAAGCAACTGCAAAAAAATGCAGCCCAAGCAGGTGTTTCGAAAACC
AACAATTATGCCACGGAGGCCACCGTTCAAGTGAATCGGCCCTTCAAGCT
GCACCGCCTGGACGAAGGACCCGCCACGGAAGTGAAGCTGACCAAGGATC
AGGCCCTTAAGTACTACACACAGATGCAGACGATCCGTCGGTTGGAGACG
GCCGCCGGTAATCTGTACAAGGAGAAGATCATTCGCGGCTTCTGTCATCT
GTATTCCGGCCAGGAGGCATGCGCCGTTGGCATGAAGGCGGCGATGCGGG
ATGTGGACAACATCATATCGGCGTACCGTGTCCACGGATGGACCTACCTG
ATGGGCGTCTCACCCAGCGGCGTACTGGCTGAGCTCACCGGTGTCCAGGG
TGGCTGTGCCCGCGGCAAGGGTGGCTCCATGCACATGTACGCACCGAACT
TCTACGGAGGCAATGGCATCGTGGGTGCTCAAGTTCCTTTGGGCGCCGGC
GTTGGCTTGGCCTGCAAGTACAAGGGCAATGGCGGCATGTGCCTGGCCCT
CTACGGTGATGGTGCCGCCAATCAGGGACAGGTGTTCGAGGCCTACAACA
TGGCCTACCTGTGGAAACTGCCTGTGATCTTTGTCTGCGAGAACAACAAC
TACGGAATGGGTACCAGTTCTGAGCGTGCTTCCTGCAACACTGATTACTA
TACCCGCGGCGACGCTCTGCCCGGAATCTGGGTGGACGGCATGGATGTGC
TGGCCGTGCGCAGCGCCACCGAGTTCGCCATCAACTATGTGAACACTCAC
GGACCTTTGGTGATGGAGACGAACACGTACCGATACTCTGGACACTCCAT
GTCCGATCCGGGCACATCGTACCGCACACGCGAGGAGATCCAGGAGGTGC
GCCAGAAGCGTGATCCCATCACCTCCTTCAAGGAGCTGTGCATCGAGCTG
GGTCTGATTACCACCGATGAAGTTAAGGCCATCGATCTGAAGGTACGCAA
GGAGGTCGACGAGGCCACCGCCTTCGCCAAGTCCGATGCCGAGCTGGGCG
TGAGCCACCTCTGGACGGACGTGTACTCCAACAATCTGGAGCCCAAGCTG
CGCGGCACCATCGCCTACGATATTGATCACATCCAGGAGCGCAAGGGCGT
CAATCACTAAGTCATCGGGCCAACGAATCTGATTCGGGAACTCACAAGAA
CCTTAAACGAAACAAGAAAACCGAACAGCAAACACAAATCACTGACAGAC
AGACAAGAAGACACAATAACTCAGAAACTTGGACACAAGCGAAATCTCTA
GATCATAAGCCGAAAGTTGAACGATGAGAACCCCGTAGAACGGAACGGAT
CCGAAGAGACCCACAAAAAGCTTAGCTAATCGGAGCACTCCAACCACACA
TCGTAGCGCACCACATAACTCTGGGGTACTGCATTGGATATTATATTGCG
AACGTGTTCAATAAGGATAAAGCGAGGTGTAAATTGTTGAAAATATAAAA
ATCTAGAAAAATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA

GM13002.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4596337..4596903 239..805 2835 100 Plus
chrX 22417052 chrX 4597369..4597906 1126..1663 2690 100 Plus
chrX 22417052 chrX 4596977..4597301 804..1128 1625 100 Plus
chrX 22417052 chrX 4595223..4595380 13..170 790 100 Plus
chrX 22417052 chrX 4595607..4595675 171..239 345 100 Plus
chrX 22417052 chrX 4599113..4599578 560..1025 295 71.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0334-RD 1200 CG7010-PD 1..1200 111..1310 5910 99.5 Plus
l(1)G0334-RA 1200 CG7010-PA 1..1200 111..1310 5910 99.5 Plus
l(1)G0334-RC 1332 CG7010-PC 193..1332 171..1310 5610 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0334-RD 1667 CG7010-RD 5..1667 1..1663 8210 99.6 Plus
l(1)G0334-RA 1760 CG7010-RA 110..1760 13..1663 8165 99.6 Plus
l(1)G0334-RB 1992 CG7010-RB 500..1992 171..1663 7375 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0334-PD 399 CG7010-PD 1..399 111..1307 2097 100 Plus
l(1)G0334-PA 399 CG7010-PA 1..399 111..1307 2097 100 Plus
l(1)G0334-PC 443 CG7010-PC 1..443 111..1307 2042 90.1 Plus
l(1)G0334-PB 328 CG7010-PB 1..328 324..1307 1744 100 Plus
CG7024-PA 479 CG7024-PA 43..390 243..1286 1142 59.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4703554..4704120 239..805 2760 99.1 Plus
X 23542271 X 4704586..4705125 1126..1665 2700 100 Plus
X 23542271 X 4704194..4704518 804..1128 1610 99.7 Plus
X 23542271 X 4702434..4702591 13..170 790 100 Plus
X 23542271 X 4702824..4702892 171..239 345 100 Plus
X 23542271 X 4706325..4706790 560..1025 295 71.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4711652..4712218 239..805 2760 99.1 Plus
X 23527363 X 4712684..4713223 1126..1665 2700 100 Plus
X 23527363 X 4712292..4712616 804..1128 1610 99.6 Plus
X 23527363 X 4710532..4710689 13..170 790 100 Plus
X 23527363 X 4710922..4710990 171..239 345 100 Plus
2R 25260384 2R 5909869..5909934 1705..1640 195 86.3 Minus
X 23527363 X 4714557..4714627 694..764 190 84.5 Plus
3L 28103327 3L 1507039..1507103 1640..1704 190 86.1 Plus
Blast to na_te.dros performed on 2014-11-27 16:41:18 has no hits.

GM13002.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:56:15 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4597371..4597906 1128..1663 100   Plus
chrX 4596978..4597300 805..1127 100 -> Plus
chrX 4596338..4596902 240..804 100 -> Plus
chrX 4595607..4595675 171..239 100 -> Plus
chrX 4595224..4595380 14..170 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-05 09:00:57 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0334-RD 1..1200 111..1310 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:37:06 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0334-RA 1..1200 111..1310 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:56:15 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0334-RA 1..1200 111..1310 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-05 09:00:57 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0334-RA 160..1813 7..1663 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:37:06 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0334-RD 5..1667 1..1663 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:56:15 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0334-RD 5..1667 1..1663 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:56:15 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
X 4704588..4705123 1128..1663 100   Plus
X 4704195..4704517 805..1127 99 -> Plus
X 4703555..4704119 240..804 99 -> Plus
X 4702824..4702892 171..239 100 -> Plus
X 4702431..4702591 7..170 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:37:06 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4598621..4599156 1128..1663 100   Plus
arm_X 4598228..4598550 805..1127 99 -> Plus
arm_X 4597588..4598152 240..804 99 -> Plus
arm_X 4596857..4596925 171..239 100 -> Plus
arm_X 4596464..4596624 7..170 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:53:26 Download gff for GM13002.complete
Subject Subject Range Query Range Percent Splice Strand
X 4712686..4713221 1128..1663 100   Plus
X 4712293..4712615 805..1127 99 -> Plus
X 4711653..4712217 240..804 99 -> Plus
X 4710922..4710990 171..239 100 -> Plus
X 4710529..4710689 7..170 98 -> Plus

GM13002.hyp Sequence

Translation from 9 to 1309

> GM13002.hyp
RYIACDSRSGQSAYRKPPFTSNFCQSNENNTAKMLRTLSRVSELPIIVKQ
LQKNAAQAGVSKTNNYATEATVQVNRPFKLHRLDEGPATEVKLTKDQALK
YYTQMQTIRRLETAAGNLYKEKIIRGFCHLYSGQEACAVGMKAAMRDVDN
IISAYRVHGWTYLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAPNFYGG
NGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYL
WKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALPGIWVDGMDVLAVR
SATEFAINYVNTHGPLVMETNTYRYSGHSMSDPGTSYRTREEIQEVRQKR
DPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATAFAKSDAELGVSHL
WTDVYSNNLEPKLRGTIAYDIDHIQERKGVNH*

GM13002.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0334-PD 399 CG7010-PD 1..399 34..432 2097 100 Plus
l(1)G0334-PA 399 CG7010-PA 1..399 34..432 2097 100 Plus
l(1)G0334-PC 443 CG7010-PC 1..443 34..432 2042 90.1 Plus
l(1)G0334-PB 328 CG7010-PB 1..328 105..432 1744 100 Plus
CG7024-PA 479 CG7024-PA 43..390 78..425 1142 59.8 Plus

GM13002.pep Sequence

Translation from 110 to 1309

> GM13002.pep
MLRTLSRVSELPIIVKQLQKNAAQAGVSKTNNYATEATVQVNRPFKLHRL
DEGPATEVKLTKDQALKYYTQMQTIRRLETAAGNLYKEKIIRGFCHLYSG
QEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCA
RGKGGSMHMYAPNFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGD
GAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRG
DALPGIWVDGMDVLAVRSATEFAINYVNTHGPLVMETNTYRYSGHSMSDP
GTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVD
EATAFAKSDAELGVSHLWTDVYSNNLEPKLRGTIAYDIDHIQERKGVNH*

GM13002.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22274-PA 399 GF22274-PA 1..399 1..399 2095 96.5 Plus
Dana\GF15055-PA 403 GF15055-PA 41..399 39..395 1173 60.2 Plus
Dana\GF22275-PA 520 GF22275-PA 55..401 45..391 1143 58.8 Plus
Dana\GF18476-PA 439 GF18476-PA 128..412 100..377 283 30.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18722-PA 440 GG18722-PA 1..440 1..399 2102 90.5 Plus
Dere\GG18723-PA 480 GG18723-PA 43..390 45..392 1162 59.8 Plus
Dere\GG16874-PA 439 GG16874-PA 128..408 100..373 272 29.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12828-PA 399 GH12828-PA 1..399 1..399 2032 93.2 Plus
Dgri\GH20215-PA 513 GH20215-PA 31..384 37..390 1185 59.9 Plus
Dgri\GH18279-PA 439 GH18279-PA 127..412 99..377 298 31.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0334-PD 399 CG7010-PD 1..399 1..399 2097 100 Plus
l(1)G0334-PA 399 CG7010-PA 1..399 1..399 2097 100 Plus
l(1)G0334-PC 443 CG7010-PC 1..443 1..399 2042 90.1 Plus
l(1)G0334-PB 328 CG7010-PB 1..328 72..399 1744 100 Plus
CG7024-PA 479 CG7024-PA 43..390 45..392 1142 59.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14910-PA 399 GI14910-PA 1..399 1..399 2023 94 Plus
Dmoj\GI14124-PA 420 GI14124-PA 30..419 9..399 1262 58.5 Plus
Dmoj\GI14911-PA 461 GI14911-PA 6..353 43..390 1175 59.5 Plus
Dmoj\GI24087-PA 435 GI24087-PA 124..405 100..374 305 31.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13094-PA 399 GL13094-PA 1..399 1..399 2075 95.5 Plus
Dper\GL18702-PA 414 GL18702-PA 61..412 45..396 1203 64.2 Plus
Dper\GL13095-PA 540 GL13095-PA 58..410 38..390 1173 60.1 Plus
Dper\GL22326-PA 439 GL22326-PA 128..412 100..377 282 30.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20028-PA 399 GA20028-PA 1..399 1..399 2068 95.2 Plus
Dpse\GA25763-PA 414 GA25763-PA 61..412 45..396 1214 64.5 Plus
Dpse\GA20040-PA 533 GA20040-PA 58..410 38..390 1175 60.1 Plus
Dpse\GA20891-PA 439 GA20891-PA 128..412 100..377 282 30.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12361-PA 441 GM12361-PA 1..441 1..399 2099 90.5 Plus
Dsec\GM12362-PA 475 GM12362-PA 34..389 37..392 1170 58.4 Plus
Dsec\GM23814-PA 439 GM23814-PA 128..388 100..349 255 30.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16702-PA 392 GD16702-PA 1..392 1..399 2088 97.7 Plus
Dsim\GD16703-PA 476 GD16703-PA 35..390 37..392 1170 58.4 Plus
Dsim\GD18623-PA 439 GD18623-PA 128..388 100..349 256 30.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18942-PA 399 GJ18942-PA 1..399 1..399 2011 93 Plus
Dvir\GJ17759-PA 420 GJ17759-PA 58..419 39..399 1258 61.3 Plus
Dvir\GJ18943-PA 548 GJ18943-PA 46..399 37..390 1214 60.7 Plus
Dvir\GJ10905-PA 437 GJ10905-PA 126..405 100..372 287 30.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25306-PA 474 GK25306-PA 93..474 21..399 1981 94.8 Plus
Dwil\GK15549-PA 430 GK15549-PA 70..426 38..394 1250 63 Plus
Dwil\GK25307-PA 632 GK25307-PA 47..409 28..392 1178 58.4 Plus
Dwil\GK11824-PA 439 GK11824-PA 128..412 100..377 285 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16361-PA 438 GE16361-PA 1..438 1..399 2102 91.1 Plus
Dyak\GE16362-PA 485 GE16362-PA 43..390 45..392 1156 58.6 Plus
Dyak\GE25960-PA 439 GE25960-PA 128..408 100..373 272 29.9 Plus