Clone GM13744 Report

Search the DGRC for GM13744

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:137
Well:44
Vector:pOT2
Associated Gene/Transcriptbic-RA
Protein status:GM13744.pep: gold
Preliminary Size:1645
Sequenced Size:1476

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3644 2001-12-16 Blastp of sequenced clone
CG3644 2003-01-01 Sim4 clustering to Release 3
bic 2008-04-29 Release 5.5 accounting
bic 2008-08-15 Release 5.9 accounting
bic 2008-12-18 5.12 accounting

Clone Sequence Records

GM13744.complete Sequence

1476 bp (1476 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070860

> GM13744.complete
TGGAAAGTGCGGCATTCGATTGGCGTTTTACTGATGCGACCATTGTGTGT
ACTCAATTGAACAGATGAACGCGGAAAAGCTGAAGAAGTTGCAGGCGCAG
GTGCGCATTGGCGGCAAGGGCACCCCTCGCCGCAAGAAGAAGATCGTCCA
CTCCACGCCCGCCACCGACGACAAGAAGCTGCAGTCGTCGCTCAAGAAGC
TGTCGGTAAACACAATTCCCGGCATCGAGGAGGTGAACATCATCAAGAAC
GATGGCACCGTCATCCACTTCAACAATCCGAAGGCCCAGGCCTCGCTGCC
GACGAACACGTTTGCCATCACGGGTCATGGCGAGAACAAGACGATCACCG
AGATGGTGCCCGGCATTCTGACGCAACTGGGTCCCCAGGACATCAACCAG
CTGAAGAAGCTGGCCACGGAGATTGCCAGCAAGAGCGGCGCCGGCGGAGC
AGCCGGCTCTTCAGCCGCCGATGCCGGTGACGATGATGTGCCCGATCTGG
TCGAGAACTTCGAGGAGGTGGCCATCGCCGACACAAAGGAGGAGAAGTCC
GGTGAGGTGGCGGCCTCCGCTTAGGCTGGTCCAACCCCGCCCACCCGGGC
AAATCACACCACCACACACCGAACACAAAAACATACATACAAAACATACG
GGGCCAGGGAGCAAGACGAAGTGGCTGGCATACAGGGCAGAACCCACACA
CCAGACACGCCGGAAACACATCTACCACTTACCCATTCCGGTTCCAAATC
GGAAACGGATCCACTCCGGACTGCAACCAGCGCTTCTGCCCTGAATGGGC
CATTCTTCGTGCTCCCTCCAGCCACTTTTTTGGGGGTCATGCTACACACT
ATACTAAAATACAAAAATAAAGGCATCCGAGTGAGCGCTGAACAGAACAC
ATAAGCATAATAACTATACTTAACATACTAAGGGAACCCTTCAATCTTAA
TCTAATTGTACTAGTTTGGAACAGTCAAATGTATTTTCCAAAGCGATTAA
AGAACGTTTCCTTAACCAAAAAAAACCACAGTCTAAACAACACACACATT
CTAATTTTTGCCGCCCTCCCAAGAACAACACACACAGATGTATCTATAGA
TATATGCGCTGTCATAAAACACTATATACTATATATATACGATACGGTTT
TCGGAAGAATTGTGACGAGGTGATTAGGGGAACAACGCAGACACTCCAGA
TGAATTCATTGCCAGGTCGCGAGGACAGAGAAATATATTTTTAGCACTAC
TAGCTCTTACCGATTTTCCCCAATTTCCGACTTTTCGATGTAACCCCGCC
CTCAAGGAATCCTCAATTGAAAACGAAAACAAGCTGAGGCCACAATTTCG
ATTCGAGAACAATGTGCCCAAATTGTTGAAAGCATAGCTTATAATTTGTA
AACTATTGTTTTAGACCATCATTACCATGCATAACATTAAATGAGCTGTA
AAAACCAAAAAAAAAAAAAAAAAAAA

GM13744.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
bic-RB 1849 bic-RB 85..1541 1..1457 7285 100 Plus
bic-RA 1918 bic-RA 218..1610 65..1457 6965 100 Plus
CG11835-RA 2388 CG11835-RA 1..271 65..335 575 80.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:36:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8757640..8759095 1..1456 7280 100 Plus
chr2L 23010047 chr2L 562906..563176 335..65 575 80.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
bic-RB 510 CG3644-PB 1..510 65..574 2550 100 Plus
bic-RA 510 CG3644-PA 1..510 65..574 2550 100 Plus
CG11835-RD 2388 CG11835-PD 1..271 65..335 575 80.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:22:43 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
bic-RA 1474 CG3644-RA 83..1474 65..1456 6960 100 Plus
bic-RB 992 CG3644-RB 91..992 1..902 4510 100 Plus
CG11835-RD 3183 CG11835-RD 570..840 65..335 575 80.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
bic-PB 169 CG3644-PB 1..165 65..559 644 100 Plus
bic-PA 169 CG3644-PA 1..165 65..559 644 100 Plus
CG11835-PD 795 CG11835-PD 1..160 65..544 412 65 Plus
CG11835-PC 795 CG11835-PC 1..160 65..544 412 65 Plus
CG11835-PB 795 CG11835-PB 1..160 65..544 412 65 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12870339..12871795 1..1457 7285 100 Plus
2L 23513712 2L 562911..563181 335..65 575 80.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12871538..12872994 1..1457 7285 100 Plus
2L 23513712 2L 562911..563181 335..65 575 80.8 Minus
Blast to na_te.dros performed on 2014-11-26 21:36:13 has no hits.

GM13744.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:36:20 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8757640..8759095 1..1456 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:07:55 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RB 1..510 65..574 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:02:08 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RB 1..510 65..574 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:37 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RA 1..510 65..574 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:39 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RB 1..510 65..574 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:20 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RA 1..510 65..574 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:47 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RB 85..1540 1..1456 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:02:08 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RB 85..1540 1..1456 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:37 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RA 75..1474 55..1456 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:39 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RB 85..1540 1..1456 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:20 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
bic-RA 75..1474 55..1456 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:20 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12870339..12871794 1..1456 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:37 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8757844..8759299 1..1456 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:26 Download gff for GM13744.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12871538..12872993 1..1456 100   Plus

GM13744.pep Sequence

Translation from 64 to 573

> GM13744.pep
MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNT
IPGIEEVNIIKNDGTVIHFNNPKAQASLPTNTFAITGHGENKTITEMVPG
ILTQLGPQDINQLKKLATEIASKSGAGGAAGSSAADAGDDDVPDLVENFE
EVAIADTKEEKSGEVAASA*

GM13744.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 16:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12924-PA 171 GF12924-PA 1..171 1..169 715 93.6 Plus
Dana\GF14881-PA 833 GF14881-PA 1..153 1..153 554 68.6 Plus
Dana\GF22559-PA 538 GF22559-PA 1..87 1..87 199 46 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 16:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20341-PA 169 GG20341-PA 1..169 1..169 736 96.4 Plus
Dere\GG24640-PA 799 GG24640-PA 1..153 1..153 533 67.3 Plus
Dere\GG17843-PA 262 GG17843-PA 1..88 1..88 187 45.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 16:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21765-PA 181 GH21765-PA 1..181 1..169 679 85.1 Plus
Dgri\GH10507-PA 1112 GH10507-PA 1..155 1..153 536 67.7 Plus
Dgri\GH23829-PA 590 GH23829-PA 1..155 1..153 532 67.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
bic-PB 169 CG3644-PB 1..169 1..169 844 100 Plus
bic-PA 169 CG3644-PA 1..169 1..169 844 100 Plus
CG11835-PD 795 CG11835-PD 1..169 1..169 524 63.3 Plus
CG11835-PC 795 CG11835-PC 1..169 1..169 524 63.3 Plus
CG11835-PB 795 CG11835-PB 1..169 1..169 524 63.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 16:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19312-PA 178 GI19312-PA 1..178 1..169 690 85.4 Plus
Dmoj\GI18025-PA 913 GI18025-PA 1..154 1..153 503 69 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 16:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17017-PA 170 GL17017-PA 1..170 1..169 721 93.5 Plus
Dper\GL19254-PA 763 GL19254-PA 1..171 1..167 535 63.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 16:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17583-PA 170 GA17583-PA 1..170 1..169 721 93.5 Plus
Dpse\GA25889-PA 765 GA25889-PA 1..171 1..167 535 63.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 16:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21428-PA 169 GM21428-PA 1..169 1..169 859 99.4 Plus
Dsec\GM16657-PA 777 GM16657-PA 1..153 1..153 540 68 Plus
Dsec\GM17676-PA 263 GM17676-PA 1..95 1..95 151 36.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 16:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10924-PA 169 GD10924-PA 1..169 1..169 859 99.4 Plus
Dsim\GD17171-PA 257 GD17171-PA 1..95 1..95 152 36.8 Plus
Dsim\GD17170-PA 252 GD17170-PA 1..86 1..87 144 37.9 Plus
Dsim\GD24509-PA 252 GD24509-PA 1..86 1..87 141 37.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 16:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22190-PA 175 GJ22190-PA 1..175 1..169 691 86.3 Plus
Dvir\GJ19702-PA 825 GJ19702-PA 1..157 1..153 490 68.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 16:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20762-PA 170 GK20762-PA 1..170 1..169 702 90 Plus
Dwil\GK24431-PA 872 GK24431-PA 1..151 1..153 516 66 Plus
Dwil\GK10317-PA 260 GK10317-PA 1..88 1..88 204 46.6 Plus
Dwil\GK10318-PA 341 GK10318-PA 2..88 1..87 204 47.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 16:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\bic-PA 169 GE12499-PA 1..169 1..169 742 97.6 Plus
Dyak\GE16029-PA 830 GE16029-PA 1..153 1..153 535 67.3 Plus
Dyak\GE17140-PA 248 GE17140-PA 1..87 1..87 188 43.7 Plus

GM13744.hyp Sequence

Translation from 64 to 573

> GM13744.hyp
MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNT
IPGIEEVNIIKNDGTVIHFNNPKAQASLPTNTFAITGHGENKTITEMVPG
ILTQLGPQDINQLKKLATEIASKSGAGGAAGSSAADAGDDDVPDLVENFE
EVAIADTKEEKSGEVAASA*

GM13744.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
bic-PB 169 CG3644-PB 1..169 1..169 844 100 Plus
bic-PA 169 CG3644-PA 1..169 1..169 844 100 Plus
CG11835-PD 795 CG11835-PD 1..169 1..169 524 63.3 Plus
CG11835-PC 795 CG11835-PC 1..169 1..169 524 63.3 Plus
CG11835-PB 795 CG11835-PB 1..169 1..169 524 63.3 Plus