Clone GM13963 Report

Search the DGRC for GM13963

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:139
Well:63
Vector:pOT2
Associated Gene/TranscriptFib-RA
Protein status:GM13963.pep: gold
Preliminary Size:1151
Sequenced Size:1267

Clone Sequence Records

GM13963.complete Sequence

1267 bp assembled on 2010-12-09

GenBank Submission: BT125830.1

> GM13963.complete
GACTCAATCACATTTCGTCGAAAGTTGTATTAAAAAGTGCAAGTACAGCA
ACATAAAATGGGCAAACCAGGATTCAGTCCACGCGGTGGTGGCGGCGGCG
GCGGAGGAGGAGGAGGTGGATTCCGTGGGCGTGGTGGCGGCGGCGGCGGA
GGAGGCGGTGGATTTGGAGGCGGCCGTGGACGCGGTGGCGGCGGCGATCG
CGGTGGCCGTGGAGGATTCGGTGGTGGCCGTGGAGGAGGTGGTCGCGGTG
GTGGTGGCGGCGGCGGCCGTGGTGCCTTCGGAGGACGTGGCGGCGGCGGT
GGTCGCGGTGGCGGCGGCCGTGGAGGCGGTGGTCGCGGCGGAGGAGGACG
TGGTGGTGGTGCTGGCGGCTTCAAGGGCGGCAAGACCGTCACCATCGAGC
CGCATCGTCACGAGGGAGTGTTCATTGCGCGCGGCAAGGAGGACGCTCTG
GTCACCAGGAACTTTGTACCTGGATCCGAAGTCTACGGCGAGAAGCGCAT
CTCCGTTGAGACCAATGGCGAGAAGATTGAGTACCGCGTGTGGAATCCCT
TCCGCTCCAAGCTGGCTGCCGCCGTTCTGGGTGGCGTCGAGCAGATTCAC
ATGCCGCCGGGCTCGAAGGTTCTCTACCTGGGCGCCGCCTCCGGAACGAC
AGTCTCGCATGTGTCCGATGTGGTGGGACCCGAGGGCCTGGTCTACGCCG
TGGAGTTCTCACACCGATCCGGTCGCGATCTGATCAACGTGGCCAAGAAG
CGCACCAACATCATACCCATCATCGAGGACGCTCGCCATCCACACAAGTA
CCGCATGCTGGTGGGCATGGTGGACACCATCTTCGCCGACGTTGCCCAGC
CGGATCAGGGCCGCATTGTGGCGCTGAATGCCCAGCACTTCCTGAAGAAC
GGCGGACACTTTGTCATCTCGATCAAGGCCTCCTGCATCGACTCGACGGC
GCAGCCCGAAGCGGTATTCGCTGCCGAGGTGAAGAAGATGCAGGCGGACA
AGCTGAAGCCCCAAGAGCAGCTCACGCTGGAGCCCTACGAGCGAGACCAC
GCCGTTGTCGTTGGCGTCTACCGACCACCGCCCAAGCAGTAAGAAGTCGT
TTTCTGCTGGGTTTAGTTTTAAGGCTATTGTACTAATACAGACGAGTTGT
ATTAAGTTTCTTTTAAATATAAAACCGTAGTTATAAAGATAAATCAAAAT
GCACATTATTTTTGTAGCAGACGTACAAAATATACACAAAAACCAAAAAA
AAAAAAAAAAAAAAAAA

GM13963.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:34:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18959365..18960100 1244..509 3680 100 Minus
chr2R 21145070 chr2R 18960480..18960922 510..68 2215 100 Minus
chr2R 21145070 chr2R 18961037..18961107 71..1 355 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
Fib-RA 1035 CG9888-PA 1..1035 58..1092 5175 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
Fib-RA 1318 CG9888-RA 75..1318 1..1244 6220 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Fib-PA 344 CG9888-PA 109..344 382..1089 1218 100 Plus
CG10909-PA 349 CG10909-PA 114..342 394..1071 524 47.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23072906..23073644 1247..509 3695 100 Minus
2R 25286936 2R 23074024..23074466 510..68 2215 100 Minus
2R 25286936 2R 23074581..23074651 71..1 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23074105..23074843 1247..509 3695 100 Minus
2R 25260384 2R 23075223..23075665 510..68 2215 100 Minus
2R 25260384 2R 23075780..23075850 71..1 355 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:34:18 has no hits.

GM13963.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:50 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18961038..18961107 1..70 100   Minus
chr2R 18960855..18960919 71..135 100 <- Minus
chr2R 18960480..18960621 369..510 100 == Minus
chr2R 18959365..18960098 511..1244 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:22 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
Fib-RA 1..1035 58..1092 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:34:25 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
Fib-RA 1..1035 58..1092 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:50 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
Fib-RA 1..1035 58..1092 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:22 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
Fib-RA 70..1313 1..1244 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:34:25 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
Fib-RA 75..1318 1..1244 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:50 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
Fib-RA 75..1318 1..1244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:50 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23074582..23074651 1..70 100   Minus
2R 23074024..23074463 71..510 100 <- Minus
2R 23072909..23073642 511..1244 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:34:25 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18962105..18962174 1..70 100   Minus
arm_2R 18961547..18961986 71..510 100 <- Minus
arm_2R 18960432..18961165 511..1244 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:31 Download gff for GM13963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23075799..23075868 1..70 100   Minus
2R 23075241..23075680 71..510 100 <- Minus
2R 23074126..23074859 511..1244 100 <- Minus

GM13963.pep Sequence

Translation from 57 to 1091

> GM13963.pep
MGKPGFSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGG
RGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGG
GAGGFKGGKTVTIEPHRHEGVFIARGKEDALVTRNFVPGSEVYGEKRISV
ETNGEKIEYRVWNPFRSKLAAAVLGGVEQIHMPPGSKVLYLGAASGTTVS
HVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRM
LVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQP
EAVFAAEVKKMQADKLKPQEQLTLEPYERDHAVVVGVYRPPPKQ*

GM13963.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16918-PA 325 GF16918-PA 91..317 112..337 533 46.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17090-PA 349 GG17090-PA 114..342 113..338 566 48.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19203-PA 275 GH19203-PA 50..272 111..338 459 42 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Fib-PA 344 CG9888-PA 1..344 1..344 1844 100 Plus
CG10909-PA 349 CG10909-PA 109..342 108..338 526 46.6 Plus
Cpr47Ef-PC 612 CG13214-PC 337..484 2..108 322 53.4 Plus
Cpr47Ef-PC 612 CG13214-PC 286..419 2..108 321 55.2 Plus
Cpr47Ef-PD 601 CG13214-PD 286..419 2..108 321 55.2 Plus
Cpr47Ef-PD 601 CG13214-PD 337..475 2..107 321 53.2 Plus
Cpr47Ef-PC 612 CG13214-PC 240..361 2..108 315 54.9 Plus
Cpr47Ef-PD 601 CG13214-PD 240..361 2..108 315 54.9 Plus
Cpr47Ef-PC 612 CG13214-PC 237..354 5..108 314 57 Plus
Cpr47Ef-PC 612 CG13214-PC 366..519 2..108 314 51.3 Plus
Cpr47Ef-PD 601 CG13214-PD 237..354 5..108 314 57 Plus
Cpr47Ef-PC 612 CG13214-PC 331..454 2..108 313 58.7 Plus
Cpr47Ef-PD 601 CG13214-PD 331..454 2..108 313 58.7 Plus
Cpr47Ef-PC 612 CG13214-PC 256..388 2..108 305 55.6 Plus
Cpr47Ef-PC 612 CG13214-PC 432..551 2..108 305 61.2 Plus
Cpr47Ef-PD 601 CG13214-PD 256..388 2..108 305 55.6 Plus
Cpr47Ef-PD 601 CG13214-PD 369..508 2..108 304 54.6 Plus
TwdlT-PA 286 CG5812-PA 25..134 3..116 304 58.5 Plus
Cpr47Ef-PD 601 CG13214-PD 432..540 2..108 303 64 Plus
Cpr47Ef-PD 601 CG13214-PD 366..515 2..108 300 49.7 Plus
Cpr47Ef-PD 601 CG13214-PD 399..530 2..104 299 53 Plus
Cpr47Ef-PC 612 CG13214-PC 301..424 2..108 294 56.5 Plus
Cpr47Ef-PD 601 CG13214-PD 301..424 2..108 294 56.5 Plus
Cpr47Ef-PC 612 CG13214-PC 235..332 10..108 291 62.7 Plus
Cpr47Ef-PD 601 CG13214-PD 235..332 10..108 291 62.7 Plus
Cpr47Ef-PC 612 CG13214-PC 399..526 2..108 290 53.9 Plus
Cpr47Ef-PC 612 CG13214-PC 419..541 10..104 283 53.7 Plus
Cpr47Ef-PC 612 CG13214-PC 468..590 2..115 250 49.6 Plus
Cpr47Ef-PC 612 CG13214-PC 459..573 2..107 248 51.7 Plus
Cpr47Ef-PD 601 CG13214-PD 459..579 2..115 239 49.6 Plus
Cpr47Ef-PC 612 CG13214-PC 35..175 10..158 234 41.7 Plus
Cpr47Ef-PD 601 CG13214-PD 35..175 10..158 234 41.7 Plus
Cpr47Ef-PC 612 CG13214-PC 462..602 2..101 223 46.5 Plus
Cpr47Ef-PD 601 CG13214-PD 481..591 2..101 213 50 Plus
Cpr47Ef-PC 612 CG13214-PC 45..125 4..81 197 56.1 Plus
Cpr47Ef-PD 601 CG13214-PD 45..125 4..81 197 56.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18675-PA 334 GI18675-PA 99..334 109..344 1245 98.3 Plus
Dmoj\GI24236-PA 292 GI24236-PA 45..281 99..338 400 38.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10774-PA 342 GL10774-PA 107..342 109..344 1240 98.3 Plus
Dper\GL23158-PA 308 GL23158-PA 12..302 55..338 496 37 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24481-PA 342 GA24481-PA 107..342 109..344 1240 98.3 Plus
Dpse\GA10632-PA 309 GA10632-PA 5..302 48..338 495 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15587-PA 344 GM15587-PA 1..344 1..344 1672 99.7 Plus
Dsec\GM25973-PA 343 GM25973-PA 108..336 113..338 511 46.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20534-PA 347 GD20534-PA 112..340 113..338 524 47.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21690-PA 338 GJ21690-PA 103..338 109..344 1253 98.7 Plus
Dvir\GJ10811-PA 289 GJ10811-PA 6..281 55..340 494 37 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19601-PA 338 GK19601-PA 104..338 109..343 1250 98.7 Plus
Dwil\GK12213-PA 320 GK12213-PA 56..294 102..338 533 42.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24480-PA 347 GE24480-PA 77..340 78..338 571 44.3 Plus

GM13963.hyp Sequence

Translation from 57 to 1091

> GM13963.hyp
MGKPGFSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGG
RGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGG
GAGGFKGGKTVTIEPHRHEGVFIARGKEDALVTRNFVPGSEVYGEKRISV
ETNGEKIEYRVWNPFRSKLAAAVLGGVEQIHMPPGSKVLYLGAASGTTVS
HVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRM
LVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQP
EAVFAAEVKKMQADKLKPQEQLTLEPYERDHAVVVGVYRPPPKQ*

GM13963.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Fib-PA 344 CG9888-PA 1..344 1..344 1844 100 Plus
CG10909-PA 349 CG10909-PA 109..342 108..338 526 46.6 Plus
Cpr47Ef-PC 612 CG13214-PC 337..484 2..108 322 53.4 Plus
Cpr47Ef-PC 612 CG13214-PC 286..419 2..108 321 55.2 Plus
Cpr47Ef-PD 601 CG13214-PD 286..419 2..108 321 55.2 Plus
Cpr47Ef-PD 601 CG13214-PD 337..475 2..107 321 53.2 Plus
Cpr47Ef-PC 612 CG13214-PC 240..361 2..108 315 54.9 Plus
Cpr47Ef-PD 601 CG13214-PD 240..361 2..108 315 54.9 Plus
Cpr47Ef-PC 612 CG13214-PC 237..354 5..108 314 57 Plus
Cpr47Ef-PC 612 CG13214-PC 366..519 2..108 314 51.3 Plus
Cpr47Ef-PD 601 CG13214-PD 237..354 5..108 314 57 Plus
Cpr47Ef-PC 612 CG13214-PC 331..454 2..108 313 58.7 Plus
Cpr47Ef-PD 601 CG13214-PD 331..454 2..108 313 58.7 Plus
Cpr47Ef-PC 612 CG13214-PC 256..388 2..108 305 55.6 Plus
Cpr47Ef-PC 612 CG13214-PC 432..551 2..108 305 61.2 Plus
Cpr47Ef-PD 601 CG13214-PD 256..388 2..108 305 55.6 Plus
Cpr47Ef-PD 601 CG13214-PD 369..508 2..108 304 54.6 Plus
TwdlT-PA 286 CG5812-PA 25..134 3..116 304 58.5 Plus
Cpr47Ef-PD 601 CG13214-PD 432..540 2..108 303 64 Plus
Cpr47Ef-PD 601 CG13214-PD 366..515 2..108 300 49.7 Plus
Cpr47Ef-PD 601 CG13214-PD 399..530 2..104 299 53 Plus
Cpr47Ef-PC 612 CG13214-PC 301..424 2..108 294 56.5 Plus
Cpr47Ef-PD 601 CG13214-PD 301..424 2..108 294 56.5 Plus
Cpr47Ef-PC 612 CG13214-PC 235..332 10..108 291 62.7 Plus
Cpr47Ef-PD 601 CG13214-PD 235..332 10..108 291 62.7 Plus
Cpr47Ef-PC 612 CG13214-PC 399..526 2..108 290 53.9 Plus
Cpr47Ef-PC 612 CG13214-PC 419..541 10..104 283 53.7 Plus
Cpr47Ef-PC 612 CG13214-PC 468..590 2..115 250 49.6 Plus
Cpr47Ef-PC 612 CG13214-PC 459..573 2..107 248 51.7 Plus
Cpr47Ef-PD 601 CG13214-PD 459..579 2..115 239 49.6 Plus
Cpr47Ef-PC 612 CG13214-PC 35..175 10..158 234 41.7 Plus
Cpr47Ef-PD 601 CG13214-PD 35..175 10..158 234 41.7 Plus
Cpr47Ef-PC 612 CG13214-PC 462..602 2..101 223 46.5 Plus
Cpr47Ef-PD 601 CG13214-PD 481..591 2..101 213 50 Plus
Cpr47Ef-PC 612 CG13214-PC 45..125 4..81 197 56.1 Plus
Cpr47Ef-PD 601 CG13214-PD 45..125 4..81 197 56.1 Plus