Clone HL01263 Report

Search the DGRC for HL01263

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:12
Well:63
Vector:pBS SK-
Associated Gene/TranscriptSkpA-RA
Protein status:HL01263.pep: gold
Preliminary Size:1643
Sequenced Size:1533

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16983 2001-01-01 Release 2 assignment
CG16983 2001-11-09 Blastp of sequenced clone
CG16983 2003-01-01 Sim4 clustering to Release 3
skpA 2008-04-29 Release 5.5 accounting
skpA 2008-08-15 Release 5.9 accounting
skpA 2008-12-18 5.12 accounting

Clone Sequence Records

HL01263.complete Sequence

1533 bp (1533 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069297

> HL01263.complete
TTTTACGTGAGTATTGTGAATTTGGTGTGTTGATTTATATCTCAGTTGGA
GCCTGCGTGGAAATAGTGTCAGTACGTTTAAAGGCATCATCGTAAGGTTA
GTCGGAAAACAAATAAAAAGCCTACAAATAGCAAGCAAGAACGCTTTCGC
AACCACAAGAAAAACGAACATACGCACGCATCCATCTGTGGTAGAGTCGG
CTTGTGTGGGGGTGAGTGGATGTGTGGGTGAGCATTTCTGGAAAGTGCCG
TTCTCTATGTTTCGATTCTACTTATCCCTTCATCACCATTTCATCGTTGA
ATCATCACGAAAGAAACATCGAAAGTGCACAATCGTTTGTTATCTTTGTA
CGAAAACAACGGTGATTTCCACACAGGCATAACCTGCAAGAGTAATACGA
TACAAATTTTGATCTGATATGACCTCATTTTAGTCGGTTTGAATTTTAAA
GAGAGCGACTCTGCAAACTGCAGGGATATGAACATACAAAATTCACAAAT
GATTGTTTGCATCCTAGTTGCTTATATTCATTTACACGCATGCTTATATG
CTTACATCTGTTATCAATAATTGACGACTTGGTGCATGCGAAGCAAACGC
ATTGAAATGACTATTGGGATCCACACACTGTTAAAAAACACACTGATTGC
ACTGCCACACATTTCTCAACTAGAACCTAATGTTTTATACTGAACTTAAC
TGCAGGAAAGCCCAAAATGCCCAGCATCAAGTTGCAATCTTCGGATGAGG
AGATCTTTGACACGGATATCCAGATCGCCAAGTGCTCCGGCACTATCAAG
ACCATGCTGGAGGACTGCGGCATGGAGGACGATGAGAATGCCATTGTGCC
GTTGCCCAATGTGAATTCGACGATTCTTCGCAAGGTGCTTACCTGGGCTC
ACTACCACAAGGACGACCCCCAGCCAACGGAGGATGATGAGAGCAAGGAG
AAGCGCACAGACGACATTATCTCATGGGATGCAGATTTCCTAAAAGTCGA
CCAGGGCACACTGTTTGAGCTGATATTGGCAGCGAACTATCTGGACATTA
AGGGCCTTCTGGAGCTCACCTGCAAGACTGTTGCAAACATGATTAAGGGA
AAGACTCCCGAGGAAATACGCAAGACCTTCAACATTAAGAAGGACTTTTC
GCCCGCCGAGGAGGAGCAGGTGCGCAAGGAGAACGAGTGGTGCGAGGAGA
AGTAAAGCGCGGCATTTCGCGGGACCAACATTAAGTTGAAACAGCTAGGG
GATTCGGGAACGAATTGGATTTGCAGCATTGCAACTTTACTTAGTTGCTA
CTTTCATTTACATTTTTTTTTATTTTTAACCCCAGCAGAGACTCGATTTA
AATTGTGTATAAATGATCTGTTGCTGATTTGATTCGCGGGGTTCATTTTT
TGTCGTAAATATATCTCATATACATACATATGCGAGATTGTAACACTCTC
TTTAACCTATTGGAGTAACACTTGATTTCACTTTAATAAATATAACTACC
CAACACAAAAAAAAAAAAAAAAAAAAAAAAAAA

HL01263.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
skpA-RH 1512 skpA-RH 2..1510 1..1509 7545 100 Plus
skpA.h 1466 skpA.h 661..1464 706..1509 4020 100 Plus
skpA-RD 1563 skpA-RD 714..1517 706..1509 4020 100 Plus
skpA.h 1466 skpA.h 270..661 1..392 1960 100 Plus
skpA-RD 1563 skpA-RD 323..714 1..392 1960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 550366..551871 1..1506 7500 99.9 Plus
chr2R 21145070 chr2R 8026649..8027000 1198..847 440 75 Minus
chrX 22417052 chrX 19701474..19701892 720..1135 260 71.4 Plus
chrX 22417052 chrX 19705119..19705231 1023..1135 250 81.4 Plus
chrX 22417052 chrX 19704813..19704958 720..865 235 77.4 Plus
chr2L 23010047 chr2L 17580108..17580175 714..781 235 89.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
SkpA-RI 489 CG16983-PI 1..489 717..1205 2445 100 Plus
SkpA-RH 489 CG16983-PH 1..489 717..1205 2445 100 Plus
SkpA-RA 489 CG16983-PA 1..489 717..1205 2445 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:27:03 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
SkpA-RH 1544 CG16983-RH 39..1544 1..1506 7530 100 Plus
SkpA-RI 826 CG16983-RI 1..826 681..1506 4130 100 Plus
SkpA-RB 935 CG16983-RB 133..935 704..1506 4015 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
SkpA-PI 162 CG16983-PI 1..162 717..1202 853 100 Plus
SkpA-PH 162 CG16983-PH 1..162 717..1202 853 100 Plus
SkpA-PA 162 CG16983-PA 1..162 717..1202 853 100 Plus
SkpA-PD 162 CG16983-PD 1..162 717..1202 853 100 Plus
SkpA-PG 162 CG16983-PG 1..162 717..1202 853 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 656394..657902 1..1509 7545 100 Plus
2R 25286936 2R 12139446..12139797 1198..847 440 75 Minus
X 23542271 X 19812810..19813228 720..1135 260 71.4 Plus
X 23542271 X 19816453..19816565 1023..1135 250 81.4 Plus
X 23542271 X 19816147..19816292 720..865 235 77.4 Plus
2L 23513712 2L 17581467..17581534 714..781 235 89.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 664492..666000 1..1509 7545 100 Plus
2R 25260384 2R 12140645..12140905 1198..938 420 77.3 Minus
X 23527363 X 19824551..19824663 1023..1135 250 81.4 Plus
X 23527363 X 19821218..19821326 1027..1135 245 81.6 Plus
X 23527363 X 19824245..19824390 720..865 235 77.3 Plus
X 23527363 X 19820908..19821053 720..865 235 77.3 Plus
2L 23513712 2L 17581467..17581534 714..781 235 89.7 Plus
X 23527363 X 19831669..19831755 1136..1050 165 79.3 Minus
X 23527363 X 19831958..19832088 850..720 145 74 Minus
2R 25260384 2R 12141053..12141102 787..738 145 86 Minus
Blast to na_te.dros performed on 2014-11-27 04:42:53 has no hits.

HL01263.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:48:24 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 550366..551871 1..1506 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:11:14 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
skpA-RC 1..489 717..1205 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:31:04 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
skpA-RC 1..489 717..1205 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:39:14 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
skpA-RD 1..489 717..1205 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:58:44 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
skpA-RC 1..489 717..1205 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:48:24 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
SkpA-RA 1..489 717..1205 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:09:20 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
skpA-RH 2..1507 1..1506 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:31:04 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
skpA-RH 2..1507 1..1506 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:14 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
skpA-RH 39..1544 1..1506 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:58:44 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
skpA-RH 2..1507 1..1506 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:48:24 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
SkpA-RH 39..1544 1..1506 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:48:24 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
X 656394..657899 1..1506 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:14 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 550427..551932 1..1506 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:35:08 Download gff for HL01263.complete
Subject Subject Range Query Range Percent Splice Strand
X 664492..665997 1..1506 100   Plus

HL01263.pep Sequence

Translation from 716 to 1204

> HL01263.pep
MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVN
STILRKVLTWAHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLF
ELILAANYLDIKGLLELTCKTVANMIKGKTPEEIRKTFNIKKDFSPAEEE
QVRKENEWCEEK*

HL01263.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21176-PA 248 GF21176-PA 1..162 1..161 823 97.5 Plus
Dana\GF11136-PA 161 GF11136-PA 1..161 1..162 645 75.9 Plus
Dana\GF12644-PA 161 GF12644-PA 1..161 1..162 632 75.3 Plus
Dana\GF11848-PA 179 GF11848-PA 1..162 1..155 510 60.5 Plus
Dana\GF21823-PA 200 GF21823-PA 2..139 4..131 181 32.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12805-PA 162 GG12805-PA 1..162 1..162 845 99.4 Plus
Dere\GG22608-PA 162 GG22608-PA 1..161 1..162 635 75.3 Plus
Dere\GG20030-PA 170 GG20030-PA 1..161 1..161 492 59 Plus
Dere\GG19259-PA 157 GG19259-PA 3..156 1..161 459 55.9 Plus
Dere\GG20001-PA 160 GG20001-PA 2..140 4..138 152 26.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24518-PA 162 GH24518-PA 1..162 1..162 820 95.7 Plus
Dgri\GH19712-PA 162 GH19712-PA 1..162 1..162 819 95.7 Plus
Dgri\GH20861-PA 162 GH20861-PA 1..162 1..162 626 74.8 Plus
Dgri\GH16422-PA 160 GH16422-PA 7..158 3..149 149 30.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:22:34
Subject Length Description Subject Range Query Range Score Percent Strand
SkpA-PI 162 CG16983-PI 1..162 1..162 853 100 Plus
SkpA-PH 162 CG16983-PH 1..162 1..162 853 100 Plus
SkpA-PA 162 CG16983-PA 1..162 1..162 853 100 Plus
SkpA-PD 162 CG16983-PD 1..162 1..162 853 100 Plus
SkpA-PG 162 CG16983-PG 1..162 1..162 853 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15084-PA 162 GI15084-PA 1..162 1..162 817 95.7 Plus
Dmoj\GI20969-PA 162 GI20969-PA 1..162 1..162 639 76.1 Plus
Dmoj\GI11198-PA 148 GI11198-PA 1..141 1..142 405 55.9 Plus
Dmoj\GI12503-PA 151 GI12503-PA 2..146 4..143 181 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13359-PA 162 GL13359-PA 1..162 1..162 841 98.8 Plus
Dper\GL13358-PA 162 GL13358-PA 1..162 1..162 841 98.8 Plus
Dper\GL14141-PA 162 GL14141-PA 1..162 1..162 841 98.8 Plus
Dper\GL15335-PA 162 GL15335-PA 1..162 1..162 833 97.5 Plus
Dper\GL27172-PA 164 GL27172-PA 1..164 1..162 679 79.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14255-PA 162 GA14255-PA 1..162 1..162 839 98.1 Plus
Dpse\GA26756-PA 164 GA26756-PA 1..164 1..162 678 76.8 Plus
Dpse\GA26757-PA 164 GA26757-PA 1..164 1..162 645 75 Plus
Dpse\GA21386-PA 162 GA21386-PA 1..162 1..162 632 76.1 Plus
Dpse\GA23292-PA 132 GA23292-PA 27..132 57..162 552 98.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19084-PA 162 GM19084-PA 1..162 1..162 848 100 Plus
Dsec\GM20386-PA 161 GM20386-PA 1..161 1..162 622 74.1 Plus
Dsec\GM15542-PA 170 GM15542-PA 1..161 1..161 482 59.6 Plus
Dsec\GM22995-PA 168 GM22995-PA 16..157 4..144 385 55.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16521-PA 162 GD16521-PA 1..162 1..162 848 100 Plus
Dsim\GD25859-PA 161 GD25859-PA 1..161 1..162 624 74.1 Plus
Dsim\GD25861-PA 128 GD25861-PA 3..128 37..162 515 76.2 Plus
Dsim\GD25046-PA 170 GD25046-PA 1..161 1..161 482 59.6 Plus
Dsim\GD17469-PA 157 GD17469-PA 16..157 4..144 358 52.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18891-PA 200 GJ18891-PA 39..200 1..162 830 96.3 Plus
Dvir\GJ20688-PA 162 GJ20688-PA 1..162 1..162 637 76.7 Plus
Dvir\GJ18483-PA 150 GJ18483-PA 1..143 1..142 473 63.6 Plus
Dvir\GJ22314-PA 140 GJ22314-PA 1..137 1..149 351 53 Plus
Dvir\GJ12411-PA 159 GJ12411-PA 7..151 3..140 146 31.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16428-PA 162 GK16428-PA 1..162 1..162 835 98.1 Plus
Dwil\GK21211-PA 162 GK21211-PA 1..162 1..162 673 79 Plus
Dwil\GK17839-PA 154 GK17839-PA 1..150 1..161 639 78.9 Plus
Dwil\GK21342-PA 161 GK21342-PA 1..161 1..162 638 76.5 Plus
Dwil\GK23055-PA 154 GK23055-PA 1..154 1..157 558 67.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\skpA-PA 162 GE16631-PA 1..162 1..162 842 98.8 Plus
Dyak\GE13476-PA 162 GE13476-PA 1..161 1..162 639 75.9 Plus
Dyak\GE11566-PA 172 GE11566-PA 1..161 1..162 484 58.9 Plus
Dyak\GE11534-PA 194 GE11534-PA 36..174 4..138 146 25.5 Plus

HL01263.hyp Sequence

Translation from 716 to 1204

> HL01263.hyp
MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVN
STILRKVLTWAHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLF
ELILAANYLDIKGLLELTCKTVANMIKGKTPEEIRKTFNIKKDFSPAEEE
QVRKENEWCEEK*

HL01263.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
SkpA-PI 162 CG16983-PI 1..162 1..162 853 100 Plus
SkpA-PH 162 CG16983-PH 1..162 1..162 853 100 Plus
SkpA-PA 162 CG16983-PA 1..162 1..162 853 100 Plus
SkpA-PD 162 CG16983-PD 1..162 1..162 853 100 Plus
SkpA-PG 162 CG16983-PG 1..162 1..162 853 100 Plus