Clone HL02677 Report

Search the DGRC for HL02677

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:26
Well:77
Vector:pBS SK-
Associated Gene/Transcriptbsk-RB
Protein status:HL02677.pep: gold
Preliminary Size:1566
Sequenced Size:1441

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5680 2001-01-01 Release 2 assignment
CG5680 2001-12-14 Blastp of sequenced clone
CG5680 2003-01-01 Sim4 clustering to Release 3
bsk 2008-04-29 Release 5.5 accounting
bsk 2008-08-15 Release 5.9 accounting
bsk 2008-12-18 5.12 accounting

Clone Sequence Records

HL02677.complete Sequence

1441 bp (1441 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070865

> HL02677.complete
AAAATGCTCGCCACTTTGAGTGCCCAGTGTGTAGAATAAAATAGAAAAAA
AATCGATTTTATATTTTCACAAGAAATTCTGTACTTCTTCGTTAAATGGC
CGATATGCTCCTTGCTCTCAACTAGTAATAAATAAAATCAGTGAACAATG
ACGACAGCTCAGCACCAACACTACACCGTCGAGGTGGGGGACACCAACTT
CACCATCCACAGTCGGTACATTAATCTACGGCCCATAGGATCAGGTGCCC
AAGGAATAGTATGCGCCGCTTACGATACTATCACCCAGCAAAATGTGGCG
ATTAAGAAACTATCTCGACCATTCCAAAATGTAACCCATGCCAAGCGAGC
ATATAGGGAATTCAAGCTAATGAAGCTTGTTAACCATAAAAACATAATTG
GCTTACTTAATGCTTTTACGCCGCAAAGGAACTTGGAAGAGTTTCAGGAT
GTCTACCTGGTCATGGAGCTGATGGACGCTAATCTCTGCCAGGTCATCCA
AATGGACTTGGATCACGACAGAATGTCCTATTTGCTTTATCAAATGTTGT
GCGGAATAAAACATTTACACTCAGCAGGAATTATTCACAGAGACTTAAAG
CCATCCAATATAGTTGTAAAGGCCGACTGCACTCTAAAAATTTTGGATTT
CGGTCTGGCACGTACTGCAGGAACTACCTTTATGATGACTCCCTATGTGG
TCACCCGATATTACAGGGCTCCAGAGGTCATTTTGGGCATGGGATACACA
GAGAACGTGGACATATGGTCCGTCGGTTGCATTATGGGCGAAATGATACG
GGGCGGTGTGCTGTTTCCTGGAACGGATCATATAGATCAGTGGAATAAAA
TTATTGAGCAATTAGGTACACCATCACCCTCGTTTATGCAACGGTTACAG
CCAACCGTCCGAAACTATGTGGAAAATCGTCCTAGATACACTGGATACTC
ATTTGATAGACTTTTCCCCGATGGCTTGTTTCCAAATGATAATAATCAGA
ATAGCCGCCGGAAGGCTTCTGACGCTAGAAATCTTCTTAGTAAAATGCTA
GTCATTGATCCAGAGCAGCGGATATCTGTGGACGAGGCTTTGAAGCATGA
ATATATCAACGTGTGGTATGATGCTGAGGAAGTGGATGCTCCCGCTCCGG
AGCCATATGATCACAGCGTGGACGAAAGGGAACACACTGTGGAGCAGTGG
AAGGAGCTAATCTATGAGGAAGTCATGGACTACGAAGCACACAATACAAA
TAATAGAACGCGGTAGAGAACGACTTTTTCCTCCTTAGTCAGTCACAAGA
AAACTAAAGCTTACCAACAATACGGCGTGTATTGTTAAATTATTACAACA
AATAAAATATTCAAATTGTATTTAAAAATATAGTAACCATTAAAAAATAA
AATCAATATGCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

HL02677.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-RB 1712 bsk-RB 178..1592 1..1415 7075 100 Plus
bsk-RF 1950 bsk-RF 585..1906 94..1415 6595 99.9 Plus
bsk-RD 1887 bsk-RD 258..557 94..393 1485 99.6 Plus
bsk-RD 1887 bsk-RD 1206..1490 856..1140 1425 100 Plus
bsk-RD 1887 bsk-RD 1569..1843 1141..1415 1375 100 Plus
bsk-RD 1887 bsk-RD 881..1145 592..856 1325 100 Plus
bsk-RD 1887 bsk-RD 620..818 394..592 995 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 01:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10246709..10246993 1140..856 1425 100 Minus
chr2L 23010047 chr2L 10246359..10246630 1412..1141 1345 99.6 Minus
chr2L 23010047 chr2L 10247054..10247318 856..592 1325 100 Minus
chr2L 23010047 chr2L 10247381..10247579 592..394 995 100 Minus
chr2L 23010047 chr2L 10247951..10248120 263..94 835 99.4 Minus
chr2L 23010047 chr2L 10247642..10247772 393..263 655 100 Minus
chr2L 23010047 chr2L 10249136..10249234 99..1 495 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-RE 1119 CG5680-PE 1..1119 148..1266 5595 100 Plus
bsk-RF 1119 CG5680-PF 1..1119 148..1266 5595 100 Plus
bsk-RB 1119 CG5680-PB 1..1119 148..1266 5595 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:27:57 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-RB 1535 CG5680-RB 124..1535 1..1412 7060 100 Plus
bsk-RE 1655 CG5680-RE 337..1655 94..1412 6580 99.9 Plus
bsk-RF 1797 CG5680-RF 479..1797 94..1412 6580 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 01:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-PE 372 CG5680-PE 1..365 148..1242 1941 100 Plus
bsk-PF 372 CG5680-PF 1..365 148..1242 1941 100 Plus
bsk-PB 372 CG5680-PB 1..365 148..1242 1941 100 Plus
p38a-PC 366 CG5475-PC 10..353 172..1236 808 48.5 Plus
p38a-PB 366 CG5475-PB 10..353 172..1236 808 48.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10247852..10248136 1140..856 1425 100 Minus
2L 23513712 2L 10247499..10247773 1415..1141 1375 100 Minus
2L 23513712 2L 10248197..10248461 856..592 1325 100 Minus
2L 23513712 2L 10248524..10248722 592..394 995 100 Minus
2L 23513712 2L 10249095..10249264 263..94 835 99.4 Minus
2L 23513712 2L 10248785..10248915 393..263 655 100 Minus
2L 23513712 2L 10250280..10250378 99..1 495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10247852..10248136 1140..856 1425 100 Minus
2L 23513712 2L 10247499..10247773 1415..1141 1375 100 Minus
2L 23513712 2L 10248197..10248461 856..592 1325 100 Minus
2L 23513712 2L 10248524..10248722 592..394 995 100 Minus
2L 23513712 2L 10249095..10249264 263..94 835 99.4 Minus
2L 23513712 2L 10248785..10248915 393..263 655 100 Minus
2L 23513712 2L 10250280..10250378 99..1 495 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:27:16 has no hits.

HL02677.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:00:40 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10249137..10249234 1..98 100   Minus
chr2L 10247951..10248115 99..263 100 <- Minus
chr2L 10247642..10247771 264..393 100 <- Minus
chr2L 10247382..10247579 394..591 100 <- Minus
chr2L 10247054..10247318 592..856 100 <- Minus
chr2L 10246709..10246992 857..1140 100 <- Minus
chr2L 10246359..10246630 1141..1412 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:11:55 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 1..1119 148..1266 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:02:37 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RE 1..1119 148..1266 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:50:37 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 1..1119 148..1266 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:27:06 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 1..1119 148..1266 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:00:40 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 1..1119 148..1266 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:29:28 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 102..1513 1..1412 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:02:37 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 102..1513 1..1412 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:50:37 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 124..1535 1..1412 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:27:06 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 102..1513 1..1412 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:00:40 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 124..1535 1..1412 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:00:40 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10250281..10250378 1..98 100   Minus
2L 10249095..10249259 99..263 100 <- Minus
2L 10248785..10248914 264..393 100 <- Minus
2L 10248525..10248722 394..591 100 <- Minus
2L 10248197..10248461 592..856 100 <- Minus
2L 10247852..10248135 857..1140 100 <- Minus
2L 10247502..10247773 1141..1412 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:50:37 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10250281..10250378 1..98 100   Minus
arm_2L 10249095..10249259 99..263 100 <- Minus
arm_2L 10248785..10248914 264..393 100 <- Minus
arm_2L 10248525..10248722 394..591 100 <- Minus
arm_2L 10248197..10248461 592..856 100 <- Minus
arm_2L 10247852..10248135 857..1140 100 <- Minus
arm_2L 10247502..10247773 1141..1412 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:59 Download gff for HL02677.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10250281..10250378 1..98 100   Minus
2L 10249095..10249259 99..263 100 <- Minus
2L 10248785..10248914 264..393 100 <- Minus
2L 10248525..10248722 394..591 100 <- Minus
2L 10248197..10248461 592..856 100 <- Minus
2L 10247852..10248135 857..1140 100 <- Minus
2L 10247502..10247773 1141..1412 100 <- Minus

HL02677.pep Sequence

Translation from 147 to 1265

> HL02677.pep
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNV
AIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQ
DVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDL
KPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGY
TENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL
QPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQ
WKELIYEEVMDYEAHNTNNRTR*

HL02677.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 16:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14126-PA 371 GF14126-PA 2..371 3..372 1998 98.6 Plus
Dana\GF23057-PA 365 GF23057-PA 1..352 1..363 820 46.2 Plus
Dana\GF18893-PA 366 GF18893-PA 1..353 1..363 820 46.8 Plus
Dana\GF18894-PA 365 GF18894-PA 5..350 9..362 658 40.3 Plus
Dana\GF23805-PA 513 GF23805-PA 127..413 28..321 537 39.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 16:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23964-PA 372 GG23964-PA 1..372 1..372 2023 99.7 Plus
Dere\GG12369-PA 366 GG12369-PA 10..353 9..363 812 47.9 Plus
Dere\GG23876-PA 361 GG23876-PA 5..348 9..363 811 46.4 Plus
Dere\GG12370-PA 343 GG12370-PA 1..341 11..363 573 36.2 Plus
Dere\GG14461-PA 430 GG14461-PA 44..330 28..321 534 39.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 16:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13559-PA 369 GH13559-PA 4..369 7..372 1929 97 Plus
Dgri\GH11110-PA 361 GH11110-PA 3..348 7..363 797 46 Plus
Dgri\GH19092-PA 366 GH19092-PA 8..353 7..363 794 46.3 Plus
Dgri\GH13352-PA 378 GH13352-PA 34..370 18..363 632 39.5 Plus
Dgri\GH14986-PA 546 GH14986-PA 160..446 28..321 536 39.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-PE 372 CG5680-PE 1..372 1..372 1979 100 Plus
bsk-PF 372 CG5680-PF 1..372 1..372 1979 100 Plus
bsk-PB 372 CG5680-PB 1..372 1..372 1979 100 Plus
p38a-PC 366 CG5475-PC 10..353 9..363 808 48.5 Plus
p38a-PB 366 CG5475-PB 10..353 9..363 808 48.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 16:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10639-PA 366 GI10639-PA 5..365 8..368 1917 97 Plus
Dmoj\GI23428-PA 366 GI23428-PA 8..353 7..363 827 48.1 Plus
Dmoj\GI18232-PA 361 GI18232-PA 5..348 9..363 808 46.4 Plus
Dmoj\GI18259-PA 339 GI18259-PA 31..330 18..325 610 41.9 Plus
Dmoj\GI13148-PA 556 GI13148-PA 170..456 28..321 535 39.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 16:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18977-PA 371 GL18977-PA 2..371 3..372 1986 97.8 Plus
Dper\GL24141-PA 366 GL24141-PA 10..353 9..363 799 47.6 Plus
Dper\GL21224-PA 343 GL21224-PA 5..329 9..362 702 42.4 Plus
Dper\GL20446-PA 375 GL20446-PA 32..367 18..363 636 39.9 Plus
Dper\GL16513-PA 667 GL16513-PA 25..329 28..323 450 36.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 16:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20320-PA 365 GA20320-PA 1..351 1..362 810 45.8 Plus
Dpse\GA18909-PA 366 GA18909-PA 10..353 9..363 799 47.6 Plus
Dpse\GA26003-PA 338 GA26003-PA 5..324 9..362 714 42.9 Plus
Dpse\GA26518-PA 370 GA26518-PA 24..350 28..362 674 42.7 Plus
Dpse\GA17089-PA 960 GA17089-PA 25..329 28..323 448 36.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 16:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11912-PA 372 GM11912-PA 1..372 1..372 2028 100 Plus
Dsec\GM23508-PA 366 GM23508-PA 10..353 9..363 825 48.5 Plus
Dsec\GM15179-PA 365 GM15179-PA 1..352 1..363 815 45.7 Plus
Dsec\GM16932-PA 340 GM16932-PA 32..331 18..325 611 41.6 Plus
Dsec\GM23509-PA 347 GM23509-PA 26..347 30..362 553 38 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 16:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22289-PA 372 GD22289-PA 1..372 1..372 2028 100 Plus
Dsim\GD18318-PA 366 GD18318-PA 10..353 9..363 826 48.5 Plus
Dsim\GD23919-PA 365 GD23919-PA 1..352 1..363 815 45.7 Plus
Dsim\GD18319-PA 347 GD18319-PA 26..347 30..362 563 39.3 Plus
Dsim\GD14046-PA 430 GD14046-PA 44..330 28..321 534 39.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 16:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21884-PA 369 GJ21884-PA 4..369 7..372 1915 95.9 Plus
Dvir\GJ18140-PA 361 GJ18140-PA 5..348 9..363 812 46.7 Plus
Dvir\GJ14531-PA 361 GJ14531-PA 5..348 9..363 809 47.4 Plus
Dvir\GJ17518-PA 375 GJ17518-PA 31..367 18..363 637 39.8 Plus
Dvir\GJ13897-PA 519 GJ13897-PA 133..419 28..321 535 39.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 16:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12444-PA 371 GK12444-PA 2..371 3..372 1953 96.5 Plus
Dwil\GK11930-PA 365 GK11930-PA 6..352 2..363 803 46.9 Plus
Dwil\GK18192-PA 364 GK18192-PA 5..348 9..363 801 46.3 Plus
Dwil\GK18964-PA 352 GK18964-PA 5..350 9..372 595 37.4 Plus
Dwil\GK20588-PA 520 GK20588-PA 134..420 28..321 534 39.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 16:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26274-PA 372 GE26274-PA 1..372 1..372 2028 100 Plus
Dyak\GE10824-PA 366 GE10824-PA 10..353 9..363 818 47.9 Plus
Dyak\GE18678-PA 365 GE18678-PA 1..352 1..363 815 45.7 Plus
Dyak\GE11327-PA 376 GE11327-PA 32..374 18..369 636 38.9 Plus
Dyak\GE21651-PA 430 GE21651-PA 44..330 28..321 534 39.3 Plus

HL02677.hyp Sequence

Translation from 147 to 1265

> HL02677.hyp
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNV
AIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQ
DVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDL
KPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGY
TENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL
QPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQ
WKELIYEEVMDYEAHNTNNRTR*

HL02677.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-PE 372 CG5680-PE 1..372 1..372 1979 100 Plus
bsk-PF 372 CG5680-PF 1..372 1..372 1979 100 Plus
bsk-PB 372 CG5680-PB 1..372 1..372 1979 100 Plus
p38a-PC 366 CG5475-PC 10..353 9..363 808 48.5 Plus
p38a-PB 366 CG5475-PB 10..353 9..363 808 48.5 Plus