Clone HL05730 Report

Search the DGRC for HL05730

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:57
Well:30
Vector:pBS SK-
Associated Gene/TranscriptCG5823-RA
Protein status:HL05730.pep: gold
Preliminary Size:1918
Sequenced Size:1828

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5823 2001-01-01 Release 2 assignment
CG5823 2001-10-10 Blastp of sequenced clone
CG5823 2003-01-01 Sim4 clustering to Release 3
CG5823 2008-04-29 Release 5.5 accounting
CG5823 2008-08-15 Release 5.9 accounting
CG5823 2008-12-18 5.12 accounting

Clone Sequence Records

HL05730.complete Sequence

1828 bp (1828 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061029

> HL05730.complete
CATGCCAAAATAAAAGATTAAATTAAGATATTGCCAGCTCCAAACCCGGA
TATATAACCCCACAAGTGATTAATACGAATTAGGGGCATCCACTGTAGCG
GAGTAAGCTCGTGATACTACCAAAATTTACCAAAGTCAAGCCCTAGTTGT
CCCCTACACGTGTGTGAGTGTGTGTGTGCGGGTGTCGGTCGTGTGCGCCT
GTATATGTGCGTTGTTTTCTCACTCAATTTCATTGCAATTTAAAAAAAAA
TCAACAAAAACGCAGTAACAGCAGCAACAACAATTAGAAAACGCACTTGT
TACCGAGGTTGGCTGCCAGTACTAGAAAAGCAAACAATAAACAACCGAGC
TGGCGAGACTGAAATCCATCGCATGATAAACACACCGAACAAGAATCTTC
GACAGCTTCGAAATTCTGGAGAAGGACGGGCCACGTCGCTATCTTATCTG
CTACAGTGAGAGAAAAACCAGTAGGCCAGTCGTGTTCGATCATAGTTTAG
GTTTTCAAACTTGGGCGGTAGTAATTAAGTTCGTTAAAAATTAGCAAAAC
CAAAACAACACCATGTCCTCGTCGTCGACGTCCGGCGGCCGGAAGCAACC
CACTGCTGTGTCGCGCATGAAGCAGGACTATATGCGCCTCAAGCGGGATC
CCCTGCCGTACATAACCGCCGAGCCGCTGCCCAACAACATCCTCGAGTGG
CACTACTGCGTCAAGGGGCCGGAGGACTCGCCCTACTACGGCGGCTACTA
CCACGGCACCCTGCTCTTTCCGCGCGAGTTCCCATTCAAGCCGCCATCCA
TCTACATGCTGACGCCGAACGGTCGCTTCAAGACCAACACCAGACTGTGT
TTGAGTATATCAGATTTTCATCCGGACACTTGGAACCCGACTTGGTGCGT
AGGCACCATTCTCACTGGACTGCTGAGCTTCATGCTGGAGAGCACACCCA
CACTCGGATCCATCGAATCATCGAACTATGACAAGCAAATGTTTGCTCAA
AAATCACTAGCATTTAACCTGCGCAACACCAACTTCTGTGAGCTGTTTCC
GGAGATAGTCGAAGAGATCAAGCAGCGGCTGCGAGGAACACAGGCGGCAG
CTGCTGTGGACGGACCCGCTGCCAATGGAGTAAAGCGTTCCAACGGACTG
GCCAACGGAGCGAGCCTGGCATCTGCGGATGGCAATCTGGCGGTGGGCGG
CTTGGCCAATCCACTGAATGCAGCGGACGCAATCGATGGCGGGGCGGCGG
GTCAGGCGGATTTGGCCAGCGGCGGAGGAGCGGCGGTCCAGAATAGTGCA
CGGAACTCCTATCTAAACTGGCAGTCCGTCTATTCAAACCTGGTGATCAT
TATCTGCTTTGCAATTTTTGCCCTCATTGTTAATTACGTGATCAAGAACC
TGAATCAGGAATAGAATTACCGACACAGCCTCTATATTTATATAAAGAAA
TAGTTACACATCCGTATGCGTGTGCATATCTAATCTAGTTTACTTTAAAA
TAGTCTTCGTGGATTGTATACCGCTTGAGAAGTATTTACATACCCCGCTT
GATTCAAAAACAACCGCACTAGACCCCCGGCATCCATTCCCACGATTCCC
ACGATTGCTGACTTAGTCTGAAAATTATCGGCAGCAAAATTTGAAAACAC
AAGAACACACAATTCAGAACTCGACTTGTGAAATTTAAAAATTGTTTTGT
TATGTATTCATTACTATTAACGCCTAGTTTAATGCAACGTGAATAATGCC
AGAAATATGTTTGTAAATGAATAAAGAAGCCCGGCAACATATGAGCTCGT
GTACAAATTAAAAAAAAAAAAAAAAAAA

HL05730.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-RA 1883 CG5823-RA 51..1861 1..1811 9055 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13356660..13357527 1809..934 4210 99 Minus
chr3R 27901430 chr3R 13357950..13358385 863..428 2135 99.3 Minus
chr3R 27901430 chr3R 13358445..13358874 429..1 1960 98.6 Minus
chr3R 27901430 chr3R 13357587..13357661 934..860 375 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-RB 852 CG5823-PB 1..852 563..1414 4260 100 Plus
CG5823-RA 852 CG5823-PA 1..852 563..1414 4260 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:28:54 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-RA 1850 CG5823-RA 42..1850 1..1809 9045 100 Plus
CG5823-RB 1789 CG5823-RB 525..1789 545..1809 6325 100 Plus
CG5823-RB 1789 CG5823-RB 42..524 1..483 2415 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-PB 283 CG5823-PB 8..283 584..1411 1274 100 Plus
CG5823-PA 283 CG5823-PA 8..283 584..1411 1274 100 Plus
eff-PC 147 CG7425-PC 2..115 605..949 178 31.1 Plus
eff-PB 147 CG7425-PB 2..115 605..949 178 31.1 Plus
eff-PA 147 CG7425-PA 2..115 605..949 178 31.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17532323..17533200 1811..934 4390 100 Minus
3R 32079331 3R 17533623..17534058 863..428 2180 100 Minus
3R 32079331 3R 17534118..17534546 429..1 2145 100 Minus
3R 32079331 3R 17533260..17533334 934..860 375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17273154..17274031 1811..934 4390 100 Minus
3R 31820162 3R 17274454..17274889 863..428 2180 100 Minus
3R 31820162 3R 17274949..17275377 429..1 2145 100 Minus
3R 31820162 3R 17274091..17274165 934..860 375 100 Minus
Blast to na_te.dros performed 2014-11-26 19:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
Porto1 4682 Porto1 DOC5 4682bp 538..591 235..288 117 68.5 Plus

HL05730.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:08:34 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13358720..13358874 1..154 98   Minus
chr3R 13358446..13358660 213..428 99 == Minus
chr3R 13357950..13358384 429..863 99 <- Minus
chr3R 13357587..13357657 864..934 100 <- Minus
chr3R 13356660..13357526 935..1809 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:12:45 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 1..852 563..1414 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:42:03 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 1..852 563..1414 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:42:00 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 1..852 563..1414 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:10:57 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 1..852 563..1414 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:34 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 1..852 563..1414 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:24:13 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 30..1838 1..1809 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:42:02 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 30..1838 1..1809 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:42:00 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 42..1850 1..1809 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:10:57 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 30..1838 1..1809 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:34 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 42..1850 1..1809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:08:34 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17534119..17534546 1..428 100   Minus
3R 17533623..17534057 429..863 100 <- Minus
3R 17533260..17533330 864..934 100 <- Minus
3R 17532325..17533199 935..1809 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:42:00 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13359841..13360268 1..428 100   Minus
arm_3R 13359345..13359779 429..863 100 <- Minus
arm_3R 13358982..13359052 864..934 100 <- Minus
arm_3R 13358047..13358921 935..1809 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:47:13 Download gff for HL05730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17274950..17275377 1..428 100   Minus
3R 17274454..17274888 429..863 100 <- Minus
3R 17274091..17274161 864..934 100 <- Minus
3R 17273156..17274030 935..1809 100 <- Minus

HL05730.pep Sequence

Translation from 562 to 1413

> HL05730.pep
MSSSSTSGGRKQPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCV
KGPEDSPYYGGYYHGTLLFPREFPFKPPSIYMLTPNGRFKTNTRLCLSIS
DFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNYDKQMFAQKSLA
FNLRNTNFCELFPEIVEEIKQRLRGTQAAAAVDGPAANGVKRSNGLANGA
SLASADGNLAVGGLANPLNAADAIDGGAAGQADLASGGGAAVQNSARNSY
LNWQSVYSNLVIIICFAIFALIVNYVIKNLNQE*

HL05730.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 16:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18607-PA 285 GF18607-PA 1..285 1..283 1201 85 Plus
Dana\GF16080-PA 151 GF16080-PA 5..118 15..129 169 31.9 Plus
Dana\GF18131-PA 147 GF18131-PA 2..115 15..129 167 31.1 Plus
Dana\GF10262-PA 350 GF10262-PA 180..293 15..129 164 27.4 Plus
Dana\GF19231-PA 151 GF19231-PA 7..117 18..129 152 31.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 16:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16770-PA 283 GG16770-PA 1..283 1..283 1370 94 Plus
Dere\GG24787-PA 169 GG24787-PA 21..135 14..129 188 33.6 Plus
Dere\GG11277-PA 151 GG11277-PA 5..118 15..129 169 31.9 Plus
Dere\GG21088-PA 147 GG21088-PA 2..115 15..129 167 31.1 Plus
Dere\GG24249-PA 151 GG24249-PA 6..112 17..124 157 32.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 16:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17489-PA 295 GH17489-PA 12..295 10..283 1142 79 Plus
Dgri\GH15302-PA 151 GH15302-PA 5..118 15..129 169 31.9 Plus
Dgri\GH14086-PA 147 GH14086-PA 2..115 15..129 167 31.1 Plus
Dgri\GH14479-PA 324 GH14479-PA 46..166 19..126 161 32.8 Plus
Dgri\GH22592-PA 151 GH22592-PA 7..117 18..129 153 31.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-PB 283 CG5823-PB 1..283 1..283 1490 100 Plus
CG5823-PA 283 CG5823-PA 1..283 1..283 1490 100 Plus
eff-PC 147 CG7425-PC 2..115 15..129 178 31.1 Plus
eff-PB 147 CG7425-PB 2..115 15..129 178 31.1 Plus
eff-PA 147 CG7425-PA 2..115 15..129 178 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 16:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22818-PA 291 GI22818-PA 12..291 10..283 1195 79.6 Plus
Dmoj\GI22506-PA 151 GI22506-PA 5..118 15..129 169 31.9 Plus
Dmoj\GI10619-PA 147 GI10619-PA 2..115 15..129 167 31.1 Plus
Dmoj\GI13630-PA 321 GI13630-PA 41..164 16..126 165 32 Plus
Dmoj\GI22711-PA 151 GI22711-PA 7..117 18..129 153 31.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 16:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23929-PA 282 GL23929-PA 2..282 3..283 1128 76.5 Plus
Dper\GL22213-PA 151 GL22213-PA 5..118 15..129 169 31.9 Plus
Dper\GL23670-PA 147 GL23670-PA 2..115 15..129 167 31.1 Plus
Dper\GL14576-PA 282 GL14576-PA 135..246 16..129 154 27.8 Plus
Dper\GL14825-PA 151 GL14825-PA 7..117 18..129 152 31.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 16:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19156-PA 282 GA19156-PA 2..282 3..283 1129 76.5 Plus
Dpse\GA15184-PA 151 GA15184-PA 5..118 15..129 169 31.9 Plus
Dpse\GA26693-PA 147 GA26693-PA 2..115 15..129 167 31.1 Plus
Dpse\GA14886-PA 151 GA14886-PA 7..117 18..129 152 31.9 Plus
Dpse\GA25195-PA 170 GA25195-PA 23..134 16..129 149 28.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 16:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15358-PA 283 GM15358-PA 1..283 1..283 1405 97.2 Plus
Dsec\GM10669-PA 151 GM10669-PA 5..118 15..129 169 31.9 Plus
Dsec\GM25828-PA 147 GM25828-PA 2..115 15..129 167 31.1 Plus
Dsec\GM16815-PA 164 GM16815-PA 21..135 14..129 163 31 Plus
Dsec\GM16552-PA 151 GM16552-PA 6..117 17..129 163 32.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 16:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20228-PA 283 GD20228-PA 1..283 1..283 1405 97.2 Plus
Dsim\GD19645-PA 151 GD19645-PA 5..118 15..129 169 31.9 Plus
Dsim\GD23095-PA 164 GD23095-PA 21..135 14..129 169 31.9 Plus
Dsim\GD20402-PA 147 GD20402-PA 2..115 15..129 167 31.1 Plus
Dsim\GD21999-PA 151 GD21999-PA 6..117 17..129 163 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 16:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22819-PA 291 GJ22819-PA 12..291 10..283 1212 80.6 Plus
Dvir\GJ10109-PA 151 GJ10109-PA 5..118 15..129 169 31.9 Plus
Dvir\GJ22971-PA 147 GJ22971-PA 2..115 15..129 167 31.1 Plus
Dvir\GJ13967-PA 318 GJ13967-PA 41..164 16..126 165 32.8 Plus
Dvir\GJ23435-PA 151 GJ23435-PA 7..117 18..129 153 31.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 16:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13973-PA 290 GK13973-PA 1..290 1..283 1131 76.2 Plus
Dwil\GK14053-PA 151 GK14053-PA 5..118 15..129 169 31.9 Plus
Dwil\GK11688-PA 147 GK11688-PA 2..115 15..129 167 31.1 Plus
Dwil\GK20435-PA 322 GK20435-PA 43..167 15..126 167 33.3 Plus
Dwil\GK21643-PA 151 GK21643-PA 7..112 18..124 154 31.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 16:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25265-PA 283 GE25265-PA 1..283 1..283 1335 95.8 Plus
Dyak\GE17550-PA 163 GE17550-PA 9..133 4..129 196 32 Plus
Dyak\GE25319-PA 151 GE25319-PA 5..118 15..129 169 31.9 Plus
Dyak\eff-PA 147 GE26430-PA 2..115 15..129 167 31.1 Plus
Dyak\GE24917-PA 151 GE24917-PA 6..117 17..129 154 31.6 Plus

HL05730.hyp Sequence

Translation from 562 to 1413

> HL05730.hyp
MSSSSTSGGRKQPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCV
KGPEDSPYYGGYYHGTLLFPREFPFKPPSIYMLTPNGRFKTNTRLCLSIS
DFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNYDKQMFAQKSLA
FNLRNTNFCELFPEIVEEIKQRLRGTQAAAAVDGPAANGVKRSNGLANGA
SLASADGNLAVGGLANPLNAADAIDGGAAGQADLASGGGAAVQNSARNSY
LNWQSVYSNLVIIICFAIFALIVNYVIKNLNQE*

HL05730.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-PB 283 CG5823-PB 1..283 1..283 1490 100 Plus
CG5823-PA 283 CG5823-PA 1..283 1..283 1490 100 Plus
eff-PC 147 CG7425-PC 2..115 15..129 178 31.1 Plus
eff-PB 147 CG7425-PB 2..115 15..129 178 31.1 Plus
eff-PA 147 CG7425-PA 2..115 15..129 178 31.1 Plus