Clone HL08111 Report

Search the DGRC for HL08111

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:81
Well:11
Vector:pOT2
Associated Gene/Transcriptsina-RA
Protein status:HL08111.pep: gold
Preliminary Size:2200
Sequenced Size:2280

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9949 2001-01-01 Release 2 assignment
CG9949 2001-07-04 Blastp of sequenced clone
CG9949 2003-01-01 Sim4 clustering to Release 3
sina 2008-04-29 Release 5.5 accounting
sina 2008-08-15 Release 5.9 accounting
sina 2008-12-18 5.12 accounting

Clone Sequence Records

HL08111.complete Sequence

2280 bp (2280 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060358

> HL08111.complete
CCGTAAAGGCTGACTGACTGATAAAAAAGGAAACAAAAAAATAACAAGAA
AATAAAATATACACATACACACACACACCAACGCAGCGGGGCACCAATAC
CTCGGCACAATTTCTTGGAGGCAGCCTGCCATACAGAAGCACAAGAAAGC
CATTGCCGAAGCCACCGGGAGGGCGAAGAACCTGAACCTGGCGAGAATTG
CAGGGACCCAGAAGAATTGTAGACACATTCGTGCCGTTGCGAGAACCCTT
CCAATGTCCAATAAAATCAACCCGAAGCGCCGCGAACCGACAGCAGCAGC
AGCAGGAGCCGGTGCCACGGGAGTGGCCACCAACACGAGCACCTCGACCG
GATCCTCCAGTGCCGGCAACACGTCCTCGGCCAACACATCCTCGTCGTCC
AGCTCCTCGCTGTCGTCCGCCGGTGGCGGTGATGCGGGCATGTCCGCCGA
CTTGACCTCGCTGTTTGAATGCCCCGTGTGCTTTGACTATGTGCTACCGC
CGATCCTGCAGTGCTCCAGCGGGCACCTGGTGTGCGTGTCCTGTCGCTCC
AAGCTCACCTGCTGCCCCACCTGCCGCGGTCCGCTGGCGAATATCCGCAA
CCTGGCGATGGAGAAGGTTGCCTCGAACGTCAAGTTCCCGTGCAAGCACT
CCGGCTACGGATGCACCGCCTCGCTGGTTTACACGGAAAAGACAGAACAC
GAGGAGACGTGCGAGTGCCGGCCCTACCTGTGTCCGTGCCCGGGCGCCAG
CTGTAAGTGGCAGGGCCCGCTTGACCTAGTCATGCAGCATCTGATGATGT
CGCACAAGAGCATCACAACGCTGCAGGGCGAGGACATCGTGTTCCTGGCC
ACCGACATCAACCTGCCCGGCGCCGTCGATTGGGTAATGATGCAGTCCTG
CTTCGGCCACCATTTTATGCTCGTGCTGGAGAAGCAGGAGAAGTACGACG
GACACCAGCAGTTCTTTGCCATCGTTCAGCTGATCGGGTCGCGCAAGGAA
GCGGAGAACTTTGTCTATCGCCTGGAGTTGAACGGAAACCGACGCCGGCT
CACCTGGGAGGCAATGCCGCGTTCGATCCACGAGGGCGTCGCTTCCGCAA
TTCACAACTCGGACTGCCTGGTGTTCGACACGTCGATTGCGCAATTGTTC
GCCGACAATGGCAACCTGGGCATTAACGTGACCATATCTCTGGTCTAAAC
GCACTGTCAATTCGTCGGGTTCTTTCATTTCTTGTGTTTACTATTCCGAT
ACAAATACATATATAGTTTATAGCCCTCTGTTCGCATCAGGCGTCTAACT
CGTGGACAGATTGTGAGTCTGGAGATTAAGAAGAAAGAGTTTTGCAGAGT
TGTTTTATAAAAATGATTCTCTATTCTAAGAGCCACTTACATGCATATGT
ATATATATCTATGGAAATATCAGGCTGCTTCGATTATCACATTCGGCACG
ATATCGCAGTTTTCTTTGATTTTTAAGCTAAGACACTCACAATTTTCCAA
AGCGAAATGGAAAGCGTATTAAAGCAATTGCTAAGTGATGTTCAGTGTTT
ATTGCACACGTTCGTTAAACCTGTAAAACCGCGTTTAAAATTCGTATTTT
CATTTTTAGTTTGCACATGACTGTGTGTAAATCTCACTCGTTTGCAGAAA
AATGCCAAATATTTTTGGTGAGATTTCGCAGATTTGTATAACACACTTTC
CTGTCGAATGCGAAAATCGTGGCTGACCTGTATGTTTGTATGTTTAATCG
GTTCGATTGGTACTCTAGTTCTAGGACATGATTTTTCAGTTACCGCACAC
ACAATACTATATATTTCAAAGTTTCAGTGTTACCCGTTTTGTTAGTTCAT
GGGGTTCTGCTTTAGTTTAATTTAGTTCGTAAGGTCCACACACCTGGAGC
AGAGCTGCCTGCGCGTGCCCACGTGCCCACCACCTACTACAGTGAACGCT
AGGAACACACAGACCCACTCACCAAAACGAGGAGAACAGCAAGAAAGGCG
AGGAGGTCACTCATCCACTCGAACATGTACTGCAAAGTCTAGTTTAGTTA
ATGTAAATTATTTTATACAATACTTGTAAATGGTAATAAGTAAAACGAAC
AGTTTAACGAAATTAACAAACCTAATAACCCACAAAGAAAAGTAATATTT
GATAGCGATAATCTGTAATAACTCGAGAGTTGTTTGAAAGTTGCAGCCTA
AACGAAACTGCGACCCGCAATTTTGTTCATGCCAAACCATCACAAAATAA
CAAAAACACACTAAAAAAAAAAAAAAAAAA

HL08111.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
sina-RA 4435 sina-RA 1650..3926 1..2277 11370 99.9 Plus
sina.a 4364 sina.a 1583..3855 1..2277 11285 99.7 Plus
sina-RB 2723 sina-RB 70..2214 133..2277 10710 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16845799..16847928 133..2262 10620 99.9 Plus
chr3L 24539361 chr3L 16843896..16844027 1..132 660 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
sina-RC 945 CG9949-PC 1..945 254..1198 4725 100 Plus
sina-RB 945 CG9949-PB 1..945 254..1198 4725 100 Plus
sina-RA 945 CG9949-PA 1..945 254..1198 4725 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
sina-RC 3124 CG9949-RC 577..2838 1..2262 11310 100 Plus
sina-RA 3191 CG9949-RA 644..2905 1..2262 11310 100 Plus
sina-RB 2482 CG9949-RB 67..2196 133..2262 10650 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
sina-PC 314 CG9949-PC 1..314 254..1195 1284 100 Plus
sina-PB 314 CG9949-PB 1..314 254..1195 1284 100 Plus
sina-PA 314 CG9949-PA 1..314 254..1195 1284 100 Plus
sinah-PC 351 CG13030-PC 100..346 452..1195 696 55.2 Plus
CG2681-PA 626 CG2681-PA 206..319 470..805 168 34.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16856297..16858441 133..2277 10710 100 Plus
3L 28110227 3L 16854394..16854525 1..132 660 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16849397..16851541 133..2277 10710 99.9 Plus
3L 28103327 3L 16847494..16847625 1..132 660 100 Plus
Blast to na_te.dros performed 2014-11-27 11:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 613..719 366..259 132 65.5 Minus
gypsy11 4428 gypsy11 GYPSY11 4428bp 973..1033 286..343 126 72.1 Plus

HL08111.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:25:11 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16845799..16847928 133..2262 99   Plus
chr3L 16843896..16844027 1..132 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:13:44 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RB 1..945 254..1198 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:23:00 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RB 1..945 254..1198 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:05:39 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RA 1..945 254..1198 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:55:41 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RB 1..945 254..1198 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:25:11 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RA 1..945 254..1198 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:20:30 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RA 1650..3911 1..2262 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:23:00 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RA 1650..3911 1..2262 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:05:39 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RA 644..2905 1..2262 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:55:42 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RA 1650..3911 1..2262 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:25:11 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
sina-RA 644..2905 1..2262 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:25:11 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16856297..16858426 133..2262 100   Plus
3L 16854394..16854525 1..132 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:05:39 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16849397..16851526 133..2262 100   Plus
arm_3L 16847494..16847625 1..132 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:33:27 Download gff for HL08111.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16849397..16851526 133..2262 100   Plus
3L 16847494..16847625 1..132 100 -> Plus

HL08111.pep Sequence

Translation from 253 to 1197

> HL08111.pep
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSS
SSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSK
LTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHE
ETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLAT
DINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEA
ENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFA
DNGNLGINVTISLV*

HL08111.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23936-PA 322 GF23936-PA 1..322 1..314 1451 92.5 Plus
Dana\GF23937-PA 328 GF23937-PA 69..319 60..311 762 53.6 Plus
Dana\GF22449-PA 623 GF22449-PA 163..389 23..259 181 25.6 Plus
Dana\GF10226-PA 407 GF10226-PA 108..312 73..264 156 23 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\sina-PA 314 GG13584-PA 1..314 1..314 1689 100 Plus
Dere\GG13585-PA 354 GG13585-PA 103..349 67..314 774 54 Plus
Dere\GG13070-PA 161 GG13070-PA 11..161 95..314 511 53.6 Plus
Dere\GG18622-PA 635 GG18622-PA 169..326 23..184 179 29.9 Plus
Dere\GG14485-PA 409 GG14485-PA 110..226 73..179 155 31.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16597-PA 311 GH16597-PA 1..311 1..314 1473 96.8 Plus
Dgri\GH16598-PA 315 GH16598-PA 44..307 55..311 723 50.6 Plus
Dgri\GH12778-PA 666 GH12778-PA 237..483 67..314 171 24.5 Plus
Dgri\GH16998-PA 412 GH16998-PA 113..229 73..179 161 32.2 Plus
Dgri\GH22376-PA 314 GH22376-PA 142..207 67..132 152 40.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
sina-PC 314 CG9949-PC 1..314 1..314 1667 100 Plus
sina-PB 314 CG9949-PB 1..314 1..314 1667 100 Plus
sina-PA 314 CG9949-PA 1..314 1..314 1667 100 Plus
sinah-PC 351 CG13030-PC 55..346 8..314 766 47.9 Plus
CG2681-PA 626 CG2681-PA 123..319 1..184 199 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12443-PA 314 GI12443-PA 1..314 1..314 1456 95.9 Plus
Dmoj\GI12444-PA 322 GI12444-PA 72..316 67..312 741 51.2 Plus
Dmoj\GI15871-PA 558 GI15871-PA 106..324 41..259 167 26 Plus
Dmoj\GI11411-PA 407 GI11411-PA 109..225 73..179 156 31.4 Plus
Dmoj\GI22002-PA 290 GI22002-PA 143..200 67..124 151 43.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20852-PA 314 GL20852-PA 1..314 1..314 1459 95.9 Plus
Dper\GL20853-PA 340 GL20853-PA 82..333 60..312 743 49.8 Plus
Dper\GL19914-PA 632 GL19914-PA 207..396 67..259 177 27.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22147-PA 314 GA22147-PA 1..314 1..314 1459 95.9 Plus
Dpse\GA11985-PA 340 GA11985-PA 82..333 60..312 744 49.8 Plus
Dpse\GA15427-PA 630 GA15427-PA 207..396 67..259 178 27.6 Plus
Dpse\GA16940-PA 411 GA16940-PA 112..228 73..179 152 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25664-PA 314 GM25664-PA 1..314 1..314 1681 99.7 Plus
Dsec\GM25665-PA 352 GM25665-PA 56..347 8..314 786 48.2 Plus
Dsec\GM11718-PA 153 GM11718-PA 1..102 212..314 222 43.7 Plus
Dsec\GM19242-PA 627 GM19242-PA 178..388 40..257 169 24.7 Plus
Dsec\GM14088-PA 412 GM14088-PA 113..229 73..179 152 31.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14671-PA 384 GD14671-PA 1..384 1..314 1232 76 Plus
Dsim\GD14672-PA 321 GD14672-PA 25..316 8..314 785 48.2 Plus
Dsim\EG:100G10.2-PA 627 GD16617-PA 201..320 67..184 169 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\sina-PA 314 GJ12342-PA 1..314 1..314 1459 95.9 Plus
Dvir\GJ12343-PA 313 GJ12343-PA 1..307 5..312 757 45.5 Plus
Dvir\GJ13607-PA 406 GJ13607-PA 108..224 73..179 154 31.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\sina-PA 331 GK20872-PA 1..331 1..314 1423 91.2 Plus
Dwil\GK20883-PA 326 GK20883-PA 4..318 10..312 780 45.9 Plus
Dwil\GK16374-PA 652 GK16374-PA 165..409 10..259 174 24.9 Plus
Dwil\GK12313-PA 408 GK12313-PA 109..225 73..179 155 31.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19881-PA 314 GE19881-PA 1..314 1..314 1689 100 Plus
Dyak\GE19882-PA 347 GE19882-PA 16..342 4..314 773 45.8 Plus
Dyak\GE21673-PA 408 GE21673-PA 109..225 73..179 154 31.4 Plus

HL08111.hyp Sequence

Translation from 253 to 1197

> HL08111.hyp
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSS
SSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSK
LTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHE
ETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLAT
DINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEA
ENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFA
DNGNLGINVTISLV*

HL08111.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
sina-PC 314 CG9949-PC 1..314 1..314 1667 100 Plus
sina-PB 314 CG9949-PB 1..314 1..314 1667 100 Plus
sina-PA 314 CG9949-PA 1..314 1..314 1667 100 Plus
sinah-PC 351 CG13030-PC 55..346 8..314 766 47.9 Plus
CG2681-PA 626 CG2681-PA 123..319 1..184 199 28.4 Plus