Clone IP02838 Report

Search the DGRC for IP02838

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:28
Well:38
Vector:pOT2
Associated Gene/Transcriptort-RA
Protein status:IP02838.pep: gold
Preliminary Size:2165
Sequenced Size:2151

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7411 2005-01-01 Successful iPCR screen
ort 2008-04-29 Release 5.5 accounting
ort 2008-08-15 Release 5.9 accounting
ort 2008-12-18 5.12 accounting

Clone Sequence Records

IP02838.complete Sequence

2151 bp (2151 high quality bases) assembled on 2006-09-12

GenBank Submission: BT029033

> IP02838.complete
CCAAGACGTTTAGAACGGAAAAACTGAATTTTCAAAAATATTTCGAGTAA
ACTGTTAAATGCTGAAGTGTTCTGAAATATTCCTTAAAACATAGAAACCT
TCTTTGACATCTTTATAAAGCAATAAAATTCATTCGGGAAGTTTATGAAT
AGTGGTGTTATTAATCATGCCATTTGTGGCGTCAAGCTGATGGTTATGTA
ATCTCTGTGAAGATTCTAGAAATCCAACAGAAATATATTGCTTCGAAAAC
CAAGCAAAGATTACTTGACTGGAGAGGAAAGCTATTTCGAATTCATCTAA
AAACTGTAAAGAGCTCACATTAAAATGGTGTTCCAAATAATAATCCTGGT
GATCTGCACCATCTGCATGAAGCACTACGCCAAAGGGGAGTTTCAACAAA
GTCTGGCCATAACCGACATCCTGCCCGAGGACATCAAGCGTTACGACAAG
ATGAGACCGCCGAAGAAAGAGGGTCAGCCGACGATAGTCTACTTCCATGT
GACGGTGATGGGTCTGGACTCCATTGATGAGAACTCGATGACTTATGTGG
CGGATGTGTTCTTTGCACAGACGTGGAAGGATCATCGCCTGCGATTGCCG
GAGAATATGACACAGGAATACCGCCTGCTCGAGGTGGACTGGCTAAAAAA
TATGTGGCGGCCGGATTCGTTTTTCAAAAACGCCAAATCGGTGACCTTTC
AGACCATGACAATACCCAATCACTATATGTGGCTGTACAAGGATAAGACC
ATTCTGTACATGGTCAAACTAACACTGAAGCTGTCCTGCATCATGAACTT
CGCCATTTATCCTCATGATACACAGGAGTGCAAGCTGCAAATGGAAAGCC
TGTCCCACACCACGGATGACTTGATATTCCAGTGGGATCCAACAACGCCC
CTTGTGGTTGATGAAAACATCGAACTGCCGCAGGTGGCCCTCATCCGAAA
TGAAACGGCGGACTGTACCCAAGTTTATTCCACTGGCAACTTCACATGCC
TGGAGGTGGTGTTCACCCTTAAGCGTCGTTTGGTTTACTACGTTTTCAAC
ACCTACATTCCCACCTGCATGATAGTGATCATGTCATGGGTATCCTTCTG
GATCAAACCGGAGGCGGCACCAGCCCGTGTGACTCTGGGTGTCACCTCCT
TGCTAACGCTTTCCACGCAACACGCCAAATCGCAGTCGTCTTTGCCACCT
GTTTCCTATCTCAAGGCAGTGGACGCCTTTATGTCCGTTTGCACGGTGTT
CGTGTTTATGGCCCTCATGGAGTATTGTCTAATAAACATCGTCCTGAGCG
ACACGCCCATTCCCAAGCCGATGGCCTATCCACCCAAACCTGTGGCGGGA
GATGGGCCCAAGAAAGAGGGCGAGGGTGCTCCTCCTGGGGGCAGCAACTC
GACGGCCAGCAAGCAACAAGCCACCATGTTGCCACTGGCCGATGAAAAGA
TCGAGAAAATTGAGAAGATCTTTGACGAGATGACCAAGAATAGAAGGATT
GTAACCACCACACGCCGCGTGGTGCGTCCGCCATTGGACGCCGATGGTCC
GTGGATTCCGCGACAGGAGTCGCGGATAATACTGACCCCGACTATCGCTC
CGCCGCCACCGCCCCCTCAGCCAGCGGCACCGGAACCGGAACTGCCCAAG
CCGAAACTCACACCCGCCCAGGAGCGGCTCAAGCGGGCTATATATATAGA
TCGGTCCTCGCGCGTCCTTTTCCCCGCCCTCTTCGCCAGTCTGAATGGCA
TCTACTGGTGTGTGTTCTACGAGTATCTATAAGGACTACGACGACTGTGC
CCTGTAAATACTTTCGCTAGCTCTCTGGCACTCCATCCGAGTGTTAAACG
TTGATTGTTCGCATATATCGAAACGTGTATCGCAAATTTAATCTTAAGCT
TTCACGCACAAGCTTTAAGTCAATGAATTTTAAACATAGATTATTGTTAA
ACCAGAAGGATGGAAAAATGGGACAGATGGAGATCTGATTACAGGATAAA
TTACAAATTATCAATTCAATTCCTAAAATGCTTAAAGTTAATCAAGTGAC
GTAGTAGCTGATGTAGCCTAAGTGAATTGTAATTTAATGTCTCAAACAAA
TGCTTTTAATTGTAAATAAATAGAGAATCCATTTAAAAAAAAAAAAAAAA
A

IP02838.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
ort-RA 2165 ort-RA 25..2160 1..2136 10680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15486118..15486764 851..1497 3130 98.9 Plus
chr3R 27901430 chr3R 15486867..15487504 1497..2134 3115 99.2 Plus
chr3R 27901430 chr3R 15485553..15486007 396..850 2200 98.9 Plus
chr3R 27901430 chr3R 15483605..15483911 1..307 1535 100 Plus
chr3R 27901430 chr3R 15485407..15485494 308..395 440 100 Plus
chr3R 27901430 chr3R 7613542..7613740 540..738 185 72.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
ort-RA 1458 CG7411-PA 1..1458 325..1782 7290 100 Plus
HisCl1-RD 1251 CG14723-PD 232..495 475..738 285 73.9 Plus
HisCl1-RC 702 CG14723-PC 232..495 475..738 285 73.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:36:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
ort-RA 2158 CG7411-RA 25..2158 1..2134 10670 100 Plus
HisCl1-RD 1693 CG14723-RD 548..811 475..738 285 73.9 Plus
HisCl1-RC 1707 CG14723-RC 430..693 475..738 285 73.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
ort-PA 485 CG7411-PA 1..485 325..1779 1995 100 Plus
HisCl1-PB 422 CG14723-PB 50..348 391..1287 1039 65.9 Plus
HisCl1-PA 426 CG14723-PA 50..348 391..1287 1039 65.9 Plus
HisCl1-PD 416 CG14723-PD 50..342 391..1287 992 64.2 Plus
HisCl1-PC 233 CG14723-PC 50..202 391..849 573 66 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19662286..19662932 851..1497 3235 100 Plus
3R 32079331 3R 19663035..19663674 1497..2136 3200 100 Plus
3R 32079331 3R 19661721..19662175 396..850 2275 100 Plus
3R 32079331 3R 19659772..19660078 1..307 1535 100 Plus
3R 32079331 3R 19661575..19661662 308..395 440 100 Plus
3R 32079331 3R 11788021..11788219 540..738 185 72.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19403117..19403763 851..1497 3235 100 Plus
3R 31820162 3R 19403866..19404505 1497..2136 3200 100 Plus
3R 31820162 3R 19402552..19403006 396..850 2275 100 Plus
3R 31820162 3R 19400603..19400909 1..307 1535 100 Plus
3R 31820162 3R 19402406..19402493 308..395 440 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:01:59 has no hits.

IP02838.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:23:41 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15486868..15487504 1498..2134 99   Plus
chr3R 15486118..15486764 851..1497 98 -> Plus
chr3R 15485553..15486007 396..850 98 -> Plus
chr3R 15485407..15485494 308..395 100 -> Plus
chr3R 15483605..15483911 1..307 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:09 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 1..1458 325..1782 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:27:53 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 1..1458 325..1782 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:14:32 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 1..1458 325..1782 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:51:02 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 1..1458 325..1782 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:41 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 1..1458 325..1782 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:58:39 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 25..2158 1..2134 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:27:53 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 25..2158 1..2134 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:14:32 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 25..2158 1..2134 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:51:02 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 25..2158 1..2134 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:41 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 25..2158 1..2134 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:23:41 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19663036..19663672 1498..2134 100   Plus
3R 19662286..19662932 851..1497 100 -> Plus
3R 19661721..19662175 396..850 100 -> Plus
3R 19661575..19661662 308..395 100 -> Plus
3R 19659772..19660078 1..307 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:14:32 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15488758..15489394 1498..2134 100   Plus
arm_3R 15488008..15488654 851..1497 100 -> Plus
arm_3R 15487443..15487897 396..850 100 -> Plus
arm_3R 15487297..15487384 308..395 100 -> Plus
arm_3R 15485494..15485800 1..307 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:18 Download gff for IP02838.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19403867..19404503 1498..2134 100   Plus
3R 19403117..19403763 851..1497 100 -> Plus
3R 19402552..19403006 396..850 100 -> Plus
3R 19402406..19402493 308..395 100 -> Plus
3R 19400603..19400909 1..307 100 -> Plus

IP02838.pep Sequence

Translation from 324 to 1781

> IP02838.pep
MVFQIIILVICTICMKHYAKGEFQQSLAITDILPEDIKRYDKMRPPKKEG
QPTIVYFHVTVMGLDSIDENSMTYVADVFFAQTWKDHRLRLPENMTQEYR
LLEVDWLKNMWRPDSFFKNAKSVTFQTMTIPNHYMWLYKDKTILYMVKLT
LKLSCIMNFAIYPHDTQECKLQMESLSHTTDDLIFQWDPTTPLVVDENIE
LPQVALIRNETADCTQVYSTGNFTCLEVVFTLKRRLVYYVFNTYIPTCMI
VIMSWVSFWIKPEAAPARVTLGVTSLLTLSTQHAKSQSSLPPVSYLKAVD
AFMSVCTVFVFMALMEYCLINIVLSDTPIPKPMAYPPKPVAGDGPKKEGE
GAPPGGSNSTASKQQATMLPLADEKIEKIEKIFDEMTKNRRIVTTTRRVV
RPPLDADGPWIPRQESRIILTPTIAPPPPPPQPAAPEPELPKPKLTPAQE
RLKRAIYIDRSSRVLFPALFASLNGIYWCVFYEYL*

IP02838.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17611-PA 485 GF17611-PA 1..485 1..485 2411 96.3 Plus
Dana\GF18400-PA 426 GF18400-PA 48..348 21..321 1114 65.4 Plus
Dana\GF17614-PA 498 GF17614-PA 107..490 52..481 584 32.1 Plus
Dana\GF11081-PA 449 GF11081-PA 47..331 42..323 459 33.3 Plus
Dana\GF23583-PA 637 GF23583-PA 50..435 19..358 428 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23438-PA 484 GG23438-PA 1..484 1..485 2439 99.2 Plus
Dere\GG18454-PA 422 GG18454-PA 48..379 21..351 1114 60.5 Plus
Dere\GG23471-PA 453 GG23471-PA 16..445 10..481 598 31.2 Plus
Dere\GG17931-PA 496 GG17931-PA 40..493 29..482 552 30.2 Plus
Dere\GG17930-PA 512 GG17930-PA 3..501 26..484 479 27.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14967-PA 482 GH14967-PA 1..482 1..485 2372 95.5 Plus
Dgri\GH17342-PA 425 GH17342-PA 50..350 21..321 1112 65.4 Plus
Dgri\GH15301-PA 456 GH15301-PA 16..448 10..481 599 31.2 Plus
Dgri\GH11877-PA 497 GH11877-PA 40..342 29..321 547 35.9 Plus
Dgri\GH12851-PA 552 GH12851-PA 60..541 26..484 485 28.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
ort-PA 485 CG7411-PA 1..485 1..485 2573 100 Plus
HisCl1-PB 422 CG14723-PB 50..348 23..321 1107 65.9 Plus
HisCl1-PA 426 CG14723-PA 50..348 23..321 1107 65.9 Plus
HisCl1-PD 416 CG14723-PD 50..342 23..321 1060 64.2 Plus
GluClalpha-PP 456 CG7535-PP 16..448 10..481 593 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22418-PA 482 GI22418-PA 1..482 1..485 2257 93 Plus
Dmoj\GI22447-PA 425 GI22447-PA 50..350 21..321 1113 65.4 Plus
Dmoj\GI22423-PA 493 GI22423-PA 74..485 27..481 599 31.4 Plus
Dmoj\GI15665-PA 498 GI15665-PA 41..343 29..321 548 35.9 Plus
Dmoj\GI14943-PA 592 GI14943-PA 99..581 26..484 479 27.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12665-PA 445 GL12665-PA 1..445 1..485 1912 80.7 Plus
Dper\GL12390-PA 423 GL12390-PA 48..348 21..321 1113 65.4 Plus
Dper\GL12670-PA 458 GL12670-PA 16..450 10..481 555 30.1 Plus
Dper\GL17174-PA 449 GL17174-PA 47..331 42..323 464 33.3 Plus
Dper\GL25394-PA 453 GL25394-PA 4..442 67..484 431 28.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\ort-PA 488 GA20331-PA 1..488 1..485 2291 92.4 Plus
Dpse\GA13205-PA 423 GA13205-PA 48..348 21..321 1113 65.4 Plus
Dpse\GA20421-PB 452 GA20421-PB 16..444 10..481 612 31.4 Plus
Dpse\GA20421-PA 456 GA20421-PA 16..448 10..481 603 31.4 Plus
Dpse\GA20421-PE 342 GA20421-PE 16..330 10..321 582 37.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26856-PA 485 GM26856-PA 1..485 1..485 2582 99.6 Plus
Dsec\GM23979-PA 426 GM23979-PA 48..348 21..321 1113 65.4 Plus
Dsec\GM26860-PA 456 GM26860-PA 16..448 10..481 601 31.4 Plus
Dsec\GM22598-PA 510 GM22598-PA 3..499 26..484 476 27.7 Plus
Dsec\GM20489-PA 449 GM20489-PA 47..331 42..323 460 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ort-PA 485 GD19307-PA 1..485 1..485 2582 99.6 Plus
Dsim\GD24824-PA 496 GD24824-PA 40..493 29..482 552 30.2 Plus
Dsim\GD18784-PA 225 GD18784-PA 1..151 171..321 548 64.9 Plus
Dsim\GD19310-PA 448 GD19310-PA 16..438 10..481 521 29.8 Plus
Dsim\GD25951-PA 449 GD25951-PA 47..331 42..323 460 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\ort-PA 482 GJ10978-PA 1..482 1..485 2337 94.4 Plus
Dvir\GJ11009-PA 425 GJ11009-PA 50..350 21..321 1112 65.4 Plus
Dvir\GJ10981-PA 456 GJ10981-PA 16..448 10..481 599 31.2 Plus
Dvir\GJ19199-PA 497 GJ19199-PA 40..342 29..321 548 35.9 Plus
Dvir\GJ18972-PA 534 GJ18972-PA 64..523 26..484 477 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22347-PA 489 GK22347-PA 1..489 1..485 2262 92.1 Plus
Dwil\GK12944-PA 424 GK12944-PA 50..381 21..351 1113 60.5 Plus
Dwil\GK22351-PA 454 GK22351-PA 16..446 10..481 583 31.4 Plus
Dwil\GK17727-PA 497 GK17727-PA 40..342 29..321 550 35.9 Plus
Dwil\GK17720-PA 562 GK17720-PA 59..551 26..484 468 26.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25619-PA 485 GE25619-PA 1..485 1..485 2573 99 Plus
Dyak\GE24203-PA 422 GE24203-PA 48..379 21..351 1114 60.5 Plus
Dyak\GE25622-PA 456 GE25622-PA 16..448 10..481 601 31.4 Plus
Dyak\GE17238-PA 496 GE17238-PA 40..493 29..482 553 30.2 Plus
Dyak\GE17237-PA 512 GE17237-PA 3..501 26..484 477 27.7 Plus

IP02838.hyp Sequence

Translation from 324 to 1781

> IP02838.hyp
MVFQIIILVICTICMKHYAKGEFQQSLAITDILPEDIKRYDKMRPPKKEG
QPTIVYFHVTVMGLDSIDENSMTYVADVFFAQTWKDHRLRLPENMTQEYR
LLEVDWLKNMWRPDSFFKNAKSVTFQTMTIPNHYMWLYKDKTILYMVKLT
LKLSCIMNFAIYPHDTQECKLQMESLSHTTDDLIFQWDPTTPLVVDENIE
LPQVALIRNETADCTQVYSTGNFTCLEVVFTLKRRLVYYVFNTYIPTCMI
VIMSWVSFWIKPEAAPARVTLGVTSLLTLSTQHAKSQSSLPPVSYLKAVD
AFMSVCTVFVFMALMEYCLINIVLSDTPIPKPMAYPPKPVAGDGPKKEGE
GAPPGGSNSTASKQQATMLPLADEKIEKIEKIFDEMTKNRRIVTTTRRVV
RPPLDADGPWIPRQESRIILTPTIAPPPPPPQPAAPEPELPKPKLTPAQE
RLKRAIYIDRSSRVLFPALFASLNGIYWCVFYEYL*

IP02838.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
ort-PA 485 CG7411-PA 1..485 1..485 2573 100 Plus
HisCl1-PB 422 CG14723-PB 50..348 23..321 1107 65.9 Plus
HisCl1-PA 426 CG14723-PA 50..348 23..321 1107 65.9 Plus
HisCl1-PD 416 CG14723-PD 50..342 23..321 1060 64.2 Plus
GluClalpha-PP 456 CG7535-PP 16..448 10..481 593 31.4 Plus